(data stored in ACNUC7421 zone)

EMBL: CP001630.PE36

CP001630.PE36        Location/Qualifiers
FT   CDS             complement(40316..40678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34010"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCI9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34010.1"
FT                   /translation="MDEILGQVLRNAVWERLDLLTELASQADAPSLLSVARSELPRLTE
FT                   GWRALLAAHEPDDKGNCPECSGRWRQQKSPCSVWRAAYEHLVAGGLAPRPARHLRTAPV
FT                   TPPVTRSRRGVAVRAH"
     MDEILGQVLR NAVWERLDLL TELASQADAP SLLSVARSEL PRLTEGWRAL LAAHEPDDKG        60
     NCPECSGRWR QQKSPCSVWR AAYEHLVAGG LAPRPARHLR TAPVTPPVTR SRRGVAVRAH       120
//

If you have problems or comments...

PBIL Back to PBIL home page