(data stored in ACNUC7421 zone)

EMBL: CP001630.PE360

CP001630.PE360       Location/Qualifiers
FT   CDS             395536..396153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0365"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: YALI0C03894p"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34334"
FT                   /db_xref="InterPro:IPR036182"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGL8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34334.1"
FT                   /translation="MAAVNGASGDVGVIAVRDAQLQFPVEEGRYATGGSAPLVVTIVNN
FT                   GTELDRLTSVTSTATGEAELSGDVELEPTTSIVAETAENAPGSSSARPTTTSAPSSASA
FT                   PSSGQPSSGQSSASSASSAPQSAASQSSQPSAAPSSGRPSSAPEATAEPGEVRIVLPDF
FT                   KQDVRPGQTIKVTFRFEKAGQLTLDVPIGATPEARVEQKSEH"
     MAAVNGASGD VGVIAVRDAQ LQFPVEEGRY ATGGSAPLVV TIVNNGTELD RLTSVTSTAT        60
     GEAELSGDVE LEPTTSIVAE TAENAPGSSS ARPTTTSAPS SASAPSSGQP SSGQSSASSA       120
     SSAPQSAASQ SSQPSAAPSS GRPSSAPEAT AEPGEVRIVL PDFKQDVRPG QTIKVTFRFE       180
     KAGQLTLDVP IGATPEARVE QKSEH                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page