(data stored in ACNUC7421 zone)

EMBL: CP001630.PE361

CP001630.PE361       Location/Qualifiers
FT   CDS             396591..397979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0366"
FT                   /product="DNA repair protein RadA"
FT                   /EC_number="2.1.1.63"
FT                   /note="KEGG: ppd:Ppro_0422 DNA repair protein RadA;
FT                   TIGRFAM: DNA repair protein RadA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34335"
FT                   /db_xref="GOA:C6WGL9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGL9"
FT                   /inference="protein motif:TFAM:TIGR00416"
FT                   /protein_id="ACU34335.1"
FT                   /translation="MAKNVRAARPVYRCAECGHEVSKWVGRCPECQAWGTVEERGVAAP
FT                   ARFLAGATSGDARPIGQVDIESSRASATGVGELDRVLGGGLVPGAVVLLAGEPGVGKST
FT                   LLLEVAHQWASTVGRCLYVTGEESAGQVRLRADRTGNLHDEIYLAAESDISAVLGQVDA
FT                   VKPSMMIVDSVQTMSSLSIDGMPGGVSQVRAVTSGLISVAKERNLPIILVGHVTKDGSV
FT                   AGPRVLEHLVDVVLQFEGDRHSTLRLLRGIKNRFGAADEVGCFELRDDGIVGVPDPSGL
FT                   FLNRREQDVTGSAVTVVVEGKRPLLGEVQALVAPTSLPAPRRAVSGLDSARVAMVMAVL
FT                   EKRGRVPLGNKDVFAATVGGMRLVEPSVDLALALAVASAAVDQPLPHDLVVVGEVGLSG
FT                   ELRRVNGVGRRLSEAARLGYTRALVPPDAGPLPKETRALVANDLGEALRLLKITGKRGS
FT                   SKDE"
     MAKNVRAARP VYRCAECGHE VSKWVGRCPE CQAWGTVEER GVAAPARFLA GATSGDARPI        60
     GQVDIESSRA SATGVGELDR VLGGGLVPGA VVLLAGEPGV GKSTLLLEVA HQWASTVGRC       120
     LYVTGEESAG QVRLRADRTG NLHDEIYLAA ESDISAVLGQ VDAVKPSMMI VDSVQTMSSL       180
     SIDGMPGGVS QVRAVTSGLI SVAKERNLPI ILVGHVTKDG SVAGPRVLEH LVDVVLQFEG       240
     DRHSTLRLLR GIKNRFGAAD EVGCFELRDD GIVGVPDPSG LFLNRREQDV TGSAVTVVVE       300
     GKRPLLGEVQ ALVAPTSLPA PRRAVSGLDS ARVAMVMAVL EKRGRVPLGN KDVFAATVGG       360
     MRLVEPSVDL ALALAVASAA VDQPLPHDLV VVGEVGLSGE LRRVNGVGRR LSEAARLGYT       420
     RALVPPDAGP LPKETRALVA NDLGEALRLL KITGKRGSSK DE                          462
//

If you have problems or comments...

PBIL Back to PBIL home page