(data stored in ACNUC7421 zone)

EMBL: CP001630.PE362

CP001630.PE362       Location/Qualifiers
FT   CDS             complement(398370..399224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0367"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   bur:Bcep18194_B2467 XRE family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34336"
FT                   /db_xref="GOA:C6WGM0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGM0"
FT                   /inference="protein motif:SMART:SM00530"
FT                   /protein_id="ACU34336.1"
FT                   /translation="MAQNNAELADFLKRARAQGDPERAGLPPDGRVRRVPGLRREEVAR
FT                   LAGVSTDYYTRLEQGRRIVPSPAVVDALGRALGLDDAGQAHLRDLIGVGGPVGRRRTTG
FT                   AQRLRPGVHQLFDSLDGVPALALGRRTDVLAANRLARALFTDFEAIPAPRRNYARWMFL
FT                   DPAARALFADWEAQARNAVESLRLEVGRDPGDRATLALLAELRELSPEFDRWWEQHRVH
FT                   QRTHGSKRLTHPLVGELTVEYETVALPGDPDTTLFLYTTAAGTASRQALDLLASWTLTA
FT                   LAR"
     MAQNNAELAD FLKRARAQGD PERAGLPPDG RVRRVPGLRR EEVARLAGVS TDYYTRLEQG        60
     RRIVPSPAVV DALGRALGLD DAGQAHLRDL IGVGGPVGRR RTTGAQRLRP GVHQLFDSLD       120
     GVPALALGRR TDVLAANRLA RALFTDFEAI PAPRRNYARW MFLDPAARAL FADWEAQARN       180
     AVESLRLEVG RDPGDRATLA LLAELRELSP EFDRWWEQHR VHQRTHGSKR LTHPLVGELT       240
     VEYETVALPG DPDTTLFLYT TAAGTASRQA LDLLASWTLT ALAR                        284
//

If you have problems or comments...

PBIL Back to PBIL home page