(data stored in ACNUC7421 zone)

EMBL: CP001630.PE363

CP001630.PE363       Location/Qualifiers
FT   CDS             399383..400234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0368"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: reh:H16_B1910 short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34337"
FT                   /db_xref="GOA:C6WGM1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGM1"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACU34337.1"
FT                   /translation="MTTPTTWFVTGASKGLGLELVRQLLAQGANVAATSRSADRLRAAL
FT                   ADADADTTRLLPLAVDLADEADVQRAVTAAAERFGRLDVVVNNAGYGYLAAVEETTAQA
FT                   VRDMLDVQVVGVWNVLRAALPVMREQRSGRVVNVSSVLGLVSLPGWALYCAGKFALEAM
FT                   TEALAGEVAGHGIEVTLVEPGYFRTSFLSPDSLALPETTTDHYPQIRRMVADHRALQGS
FT                   QLGDPARGAAEIIARASVAGAPLRQVLGSDSHAYATAKVDALRANLAAEADSAPRTDHP
FT                   AA"
     MTTPTTWFVT GASKGLGLEL VRQLLAQGAN VAATSRSADR LRAALADADA DTTRLLPLAV        60
     DLADEADVQR AVTAAAERFG RLDVVVNNAG YGYLAAVEET TAQAVRDMLD VQVVGVWNVL       120
     RAALPVMREQ RSGRVVNVSS VLGLVSLPGW ALYCAGKFAL EAMTEALAGE VAGHGIEVTL       180
     VEPGYFRTSF LSPDSLALPE TTTDHYPQIR RMVADHRALQ GSQLGDPARG AAEIIARASV       240
     AGAPLRQVLG SDSHAYATAK VDALRANLAA EADSAPRTDH PAA                         283
//

If you have problems or comments...

PBIL Back to PBIL home page