(data stored in ACNUC7421 zone)

EMBL: CP001630.PE364

CP001630.PE364       Location/Qualifiers
FT   CDS             complement(400639..403167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0370"
FT                   /product="trehalose-phosphatase"
FT                   /note="TIGRFAM: trehalose-phosphatase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: glycoside hydrolase
FT                   15-related; trehalose- phosphatase; KEGG: nmu:Nmul_A2309
FT                   glycoside hydrolase 15-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34338"
FT                   /db_xref="GOA:C6WGM2"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGM2"
FT                   /inference="protein motif:TFAM:TIGR00685"
FT                   /protein_id="ACU34338.1"
FT                   /translation="MTAEALPAELRRAIVQLARTPRLLVACDYDGTLAPIVENPEDARP
FT                   LPEAVGALRSLAGLHETTTAVISGRALRDLATLSRLPAEVHLVGSHGSEFDVGFVHALD
FT                   ADARALHRRLEDELEKLVDGSEGVSLEIKPASIAVHVRRAPAEVGERVLEAVRTGPCTW
FT                   GGVQVTEGKAVVELAVVQTDKGHALDVLRHRVSATASVFVGDDVTDEKAFARLSGPDVG
FT                   IKVGDGETLAQYHITDSPDVSMVLALLLEERRNWLHGDQAVPIERLTMLANERSVALVT
FT                   PDARVNWLCHPEPDSAAVFADLLGGPSAGHFTIKPEHGSLPLGQRYVPGTMVVETRWSR
FT                   LLVTDYLDHDLPGHRTDLVRRISGSTNAVITFAPRPEFGQVPVRLLRERDGLRVAGTSE
FT                   PMVLRSPGVDWEITSDGVQETAVAVVRPREGAAILLELRCGTDDLSESTLGEPERRARA
FT                   GGFWSDWAATLKLPSVEPELVLRSALTLKGLVHHETGAIMAAATTSLPEELGGIRNWDY
FT                   RYCWLRDAALTAQALVSVGSLTEAEAFLGWVHGVLDTLPGPERLHPLYTLQGTMLGAEA
FT                   VIDTLPGYAGSRPVRVGNLANQQVQLDVFGPVVDLVAELASARGALTDEDWRMVQAMAE
FT                   AVARRWHEPDHGIWEERHAPRHHVYSKVMCWVTLDRAVRLAEQYGRALDPSWPVLRDTI
FT                   ATDVLKNGWSDVAQSFTTAYDGDDLDAASLHVGLAGLIDPADERFQATVTAIEAELRSG
FT                   STVYRYRRDDGLPGDEGGFHLCAAWMIESYLLTGRRTEAEELFAQMVDAAGPTGLLPEE
FT                   YDPIAERSLGNHPQAYSHLGLIRCAQLLAK"
     MTAEALPAEL RRAIVQLART PRLLVACDYD GTLAPIVENP EDARPLPEAV GALRSLAGLH        60
     ETTTAVISGR ALRDLATLSR LPAEVHLVGS HGSEFDVGFV HALDADARAL HRRLEDELEK       120
     LVDGSEGVSL EIKPASIAVH VRRAPAEVGE RVLEAVRTGP CTWGGVQVTE GKAVVELAVV       180
     QTDKGHALDV LRHRVSATAS VFVGDDVTDE KAFARLSGPD VGIKVGDGET LAQYHITDSP       240
     DVSMVLALLL EERRNWLHGD QAVPIERLTM LANERSVALV TPDARVNWLC HPEPDSAAVF       300
     ADLLGGPSAG HFTIKPEHGS LPLGQRYVPG TMVVETRWSR LLVTDYLDHD LPGHRTDLVR       360
     RISGSTNAVI TFAPRPEFGQ VPVRLLRERD GLRVAGTSEP MVLRSPGVDW EITSDGVQET       420
     AVAVVRPREG AAILLELRCG TDDLSESTLG EPERRARAGG FWSDWAATLK LPSVEPELVL       480
     RSALTLKGLV HHETGAIMAA ATTSLPEELG GIRNWDYRYC WLRDAALTAQ ALVSVGSLTE       540
     AEAFLGWVHG VLDTLPGPER LHPLYTLQGT MLGAEAVIDT LPGYAGSRPV RVGNLANQQV       600
     QLDVFGPVVD LVAELASARG ALTDEDWRMV QAMAEAVARR WHEPDHGIWE ERHAPRHHVY       660
     SKVMCWVTLD RAVRLAEQYG RALDPSWPVL RDTIATDVLK NGWSDVAQSF TTAYDGDDLD       720
     AASLHVGLAG LIDPADERFQ ATVTAIEAEL RSGSTVYRYR RDDGLPGDEG GFHLCAAWMI       780
     ESYLLTGRRT EAEELFAQMV DAAGPTGLLP EEYDPIAERS LGNHPQAYSH LGLIRCAQLL       840
     AK                                                                      842
//

If you have problems or comments...

PBIL Back to PBIL home page