(data stored in ACNUC7421 zone)

EMBL: CP001630.PE365

CP001630.PE365       Location/Qualifiers
FT   CDS             complement(403246..404682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0371"
FT                   /product="Alpha,alpha-trehalose-phosphate synthase
FT                   (UDP-forming)"
FT                   /EC_number="2.4.1.15"
FT                   /note="PFAM: glycosyl transferase family 20; KEGG:
FT                   scl:sce0488 Alpha,alpha-trehalose-phosphate synthase
FT                   (UDP-forming)"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34339"
FT                   /db_xref="GOA:C6WGM3"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGM3"
FT                   /inference="protein motif:PRIAM:2.4.1.15"
FT                   /protein_id="ACU34339.1"
FT                   /translation="MSSIGENGADFLVVANRLPVDLERLPDGTQRWKHSPGGLVSALEP
FT                   FLRVHSGAWVGWPGVADADVEAFEEDGLQLHPVSLSSAEVTDYYEGFSNGTLWPLYHDV
FT                   VERPAFHRRWWNTYVRVNQRFADVTAKVAAHGATVWVQDYQLQLVPAMLRELRPDLRIG
FT                   FFLHIPFPPVELFMQLPWRTEIIRGLLGADLVGFHRPGGAQNFLWLARRLVGLEPSRGA
FT                   VGVRTRPGVVQVGDRTVRVGAFPISIDSSALDALARSKEVQARARQIREDLGNPKKVLL
FT                   GVDRLDYTKGIDVRLRALNELLEDGRVAPEDVVMVQLATPSRERVEHYKQMRGDIERMV
FT                   GRLNGEFSRVGRPVLHYLHQSVDRKELTAFMLAADVMVVTPVRDGMNLVCKEYVASRHD
FT                   LGGALVLSEFAGAAAELTSAFLVNPHDLDGVKKALEDALALDPAEGRRRMRALRRQVLT
FT                   HDVDRWARSFLEALGAQTAV"
     MSSIGENGAD FLVVANRLPV DLERLPDGTQ RWKHSPGGLV SALEPFLRVH SGAWVGWPGV        60
     ADADVEAFEE DGLQLHPVSL SSAEVTDYYE GFSNGTLWPL YHDVVERPAF HRRWWNTYVR       120
     VNQRFADVTA KVAAHGATVW VQDYQLQLVP AMLRELRPDL RIGFFLHIPF PPVELFMQLP       180
     WRTEIIRGLL GADLVGFHRP GGAQNFLWLA RRLVGLEPSR GAVGVRTRPG VVQVGDRTVR       240
     VGAFPISIDS SALDALARSK EVQARARQIR EDLGNPKKVL LGVDRLDYTK GIDVRLRALN       300
     ELLEDGRVAP EDVVMVQLAT PSRERVEHYK QMRGDIERMV GRLNGEFSRV GRPVLHYLHQ       360
     SVDRKELTAF MLAADVMVVT PVRDGMNLVC KEYVASRHDL GGALVLSEFA GAAAELTSAF       420
     LVNPHDLDGV KKALEDALAL DPAEGRRRMR ALRRQVLTHD VDRWARSFLE ALGAQTAV         478
//

If you have problems or comments...

PBIL Back to PBIL home page