(data stored in ACNUC7421 zone)

EMBL: CP001630.PE366

CP001630.PE366       Location/Qualifiers
FT   CDS             complement(404791..406185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0372"
FT                   /product="protein of unknown function DUF1212"
FT                   /note="PFAM: protein of unknown function DUF1212; KEGG:
FT                   rpt:Rpal_1546 protein of unknown function DUF1212"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34340"
FT                   /db_xref="GOA:C6WGM4"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGM4"
FT                   /inference="protein motif:PFAM:PF06738"
FT                   /protein_id="ACU34340.1"
FT                   /translation="MSTRRKRYREPATLPDLWRPVEGPSLPDAPVVHLVLDLALRVGEV
FT                   QLASGAGAADVAATVSAVAQAYGMPRVEVDVTFTAITVSCHRGTSAAPVTSLRVVRSRG
FT                   LDYTRLDTLEDLIRRIAENEVTAEEAYAELDRITTAPHPYPRWVATAAWAGMAASVALL
FT                   VGGGLLLALSAALVTALVDRVGRLLNRRSLPFFFQQAAGGVLATAFALALYATDLLPGV
FT                   RPSLLVATGIVVLLSGLSLVGTVQDAITGYNVTAAGRFVEIVMLTSGLIAGVALTLRAG
FT                   VQLGVLTTMADPLPALISTVPLQLATGAATSMFFALASYARPKALMVAACAGAVGTTSY
FT                   GLLAVTGLNTIVCAAAAATLVGFVGALVSRKLRTPPLVVAVAGMVPLLPGWTIYRGLYQ
FT                   LTADGDPAGLSTLVYAGGTALALASGVALGEFLGEPVRTGFGRLERRLAGPRLSGPLWP
FT                   TRRRSE"
     MSTRRKRYRE PATLPDLWRP VEGPSLPDAP VVHLVLDLAL RVGEVQLASG AGAADVAATV        60
     SAVAQAYGMP RVEVDVTFTA ITVSCHRGTS AAPVTSLRVV RSRGLDYTRL DTLEDLIRRI       120
     AENEVTAEEA YAELDRITTA PHPYPRWVAT AAWAGMAASV ALLVGGGLLL ALSAALVTAL       180
     VDRVGRLLNR RSLPFFFQQA AGGVLATAFA LALYATDLLP GVRPSLLVAT GIVVLLSGLS       240
     LVGTVQDAIT GYNVTAAGRF VEIVMLTSGL IAGVALTLRA GVQLGVLTTM ADPLPALIST       300
     VPLQLATGAA TSMFFALASY ARPKALMVAA CAGAVGTTSY GLLAVTGLNT IVCAAAAATL       360
     VGFVGALVSR KLRTPPLVVA VAGMVPLLPG WTIYRGLYQL TADGDPAGLS TLVYAGGTAL       420
     ALASGVALGE FLGEPVRTGF GRLERRLAGP RLSGPLWPTR RRSE                        464
//

If you have problems or comments...

PBIL Back to PBIL home page