(data stored in ACNUC7421 zone)

EMBL: CP001630.PE367

CP001630.PE367       Location/Qualifiers
FT   CDS             407108..408085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0374"
FT                   /product="putative transcriptional regulator, ArsR family"
FT                   /note="SMART: regulatory protein ArsR; KEGG: ajs:Ajs_2855
FT                   ArsR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34341"
FT                   /db_xref="GOA:C6WGM5"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGM5"
FT                   /inference="protein motif:SMART:SM00418"
FT                   /protein_id="ACU34341.1"
FT                   /translation="MAVLRIHFTDADLARTRVARDPDPLWETVLGLYRLANDDVPVFEP
FT                   WRNRARLAVVERGAQAQVRMVRQLVPREGYFPDFLTPAEGRHGVAAGLEAVRGTPSLRL
FT                   LGDIAYAARSRPLPAWAHRVARSDRDALDELVSALKGVHDVLVRPAWEDAQAAVAAERA
FT                   ALGRTILDAGVDAALETLRPTLRWNPPVLEADYPKPLDVRLGGRGALLVPSYFCWGNPV
FT                   ALVDPALPPVIVYPVRHPANWTPDRSRSLGALLGRTRAAVLAALTGTATTTELAARLRL
FT                   SPASASEHVGVLRDSGLVVSRREGRTVLHSLTPLAQSLLEGRRA"
     MAVLRIHFTD ADLARTRVAR DPDPLWETVL GLYRLANDDV PVFEPWRNRA RLAVVERGAQ        60
     AQVRMVRQLV PREGYFPDFL TPAEGRHGVA AGLEAVRGTP SLRLLGDIAY AARSRPLPAW       120
     AHRVARSDRD ALDELVSALK GVHDVLVRPA WEDAQAAVAA ERAALGRTIL DAGVDAALET       180
     LRPTLRWNPP VLEADYPKPL DVRLGGRGAL LVPSYFCWGN PVALVDPALP PVIVYPVRHP       240
     ANWTPDRSRS LGALLGRTRA AVLAALTGTA TTTELAARLR LSPASASEHV GVLRDSGLVV       300
     SRREGRTVLH SLTPLAQSLL EGRRA                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page