(data stored in ACNUC7421 zone)

EMBL: CP001630.PE368

CP001630.PE368       Location/Qualifiers
FT   CDS             complement(408188..409822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0375"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; KEGG: aba:Acid345_1672 methyl-accepting chemotaxis
FT                   sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34342"
FT                   /db_xref="GOA:C6WGM6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGM6"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACU34342.1"
FT                   /translation="MGNPTDRSATTGAGWWTNARVSVKILLAVGVVALVALVTGAVSWV
FT                   RLDTLNEQVQGIKNESMVRQANLLRVQNATAAMYRGMYLFGTADSAEGKAEGEKLVKDA
FT                   ESELDAAGSAYTSTPSTSAGWRQQVELYGASWNTYRGLLNVVLFGDAAPAGVTVPTSVA
FT                   ELGKAFTDSENGMNSAIDALSALEQAEGQAAAEAADSTVASARLWTVGVLVVGLALALL
FT                   LALLTGRSIGRRLERVRDVLASMADGDLTGSAPVDSRDEVGEMAVAVNRATENVRGAVS
FT                   ALAGSAQALAVNSRQLSSSADRIAGSAQDTAGRTDELAETSEEVSRNVQTVAAGAEQMG
FT                   AAIQEISQSASDAADVAAQAVQAAAVTNATVAKLGESSVEIGNVVKVITSIAEQTNLLA
FT                   LNATIEAARAGEAGKGFAVVANEVKDLAQETARATEDISRRVEAIQADTGGAVTAIEEI
FT                   GQIIARINDYQLTIASAVEEQTATTQEMNRGINEAAVGTTRIAGSISTVAGATRTTSAT
FT                   VVETQGAAMELSRMSAELQEQVDRFRI"
     MGNPTDRSAT TGAGWWTNAR VSVKILLAVG VVALVALVTG AVSWVRLDTL NEQVQGIKNE        60
     SMVRQANLLR VQNATAAMYR GMYLFGTADS AEGKAEGEKL VKDAESELDA AGSAYTSTPS       120
     TSAGWRQQVE LYGASWNTYR GLLNVVLFGD AAPAGVTVPT SVAELGKAFT DSENGMNSAI       180
     DALSALEQAE GQAAAEAADS TVASARLWTV GVLVVGLALA LLLALLTGRS IGRRLERVRD       240
     VLASMADGDL TGSAPVDSRD EVGEMAVAVN RATENVRGAV SALAGSAQAL AVNSRQLSSS       300
     ADRIAGSAQD TAGRTDELAE TSEEVSRNVQ TVAAGAEQMG AAIQEISQSA SDAADVAAQA       360
     VQAAAVTNAT VAKLGESSVE IGNVVKVITS IAEQTNLLAL NATIEAARAG EAGKGFAVVA       420
     NEVKDLAQET ARATEDISRR VEAIQADTGG AVTAIEEIGQ IIARINDYQL TIASAVEEQT       480
     ATTQEMNRGI NEAAVGTTRI AGSISTVAGA TRTTSATVVE TQGAAMELSR MSAELQEQVD       540
     RFRI                                                                    544
//

If you have problems or comments...

PBIL Back to PBIL home page