(data stored in ACNUC7421 zone)

EMBL: CP001630.PE369

CP001630.PE369       Location/Qualifiers
FT   CDS             complement(409989..411551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0376"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with GAF sensor"
FT                   /note="PFAM: chemotaxis sensory transducer; GAF domain
FT                   protein; SMART: chemotaxis sensory transducer; GAF domain
FT                   protein; KEGG: aba:Acid345_1672 methyl-accepting chemotaxis
FT                   sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34343"
FT                   /db_xref="GOA:C6WGM7"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGM7"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACU34343.1"
FT                   /translation="MPFTSNRVRAELARALAALAEAEQDTAAVTAVVKALDGVKSSRDA
FT                   AKAALDVVRQRFGWVYGSYWQVDGTGGALRFAVESGDAGEEFRAVTREASFAEGVGLSG
FT                   RAWRSRDLVFVGDLGTLRDCVRAPVAQKVGVKSGICFPLTENGRVVGTMDFFSLEELNP
FT                   SKQRLEVLRSIGLLVAQAMERVVDVERQAASALDIQAVNAVLRGLGSATSEEEATRQAL
FT                   DTVRSEFGWAYGSFWAVDPTGQELRYVTESGDAGEEFRKITREASFRQGVGLAGRAWKS
FT                   REMLFVPDLADMTDCVRAPAARRVGVKSGVCLPLVVHGAVVGTMDFFSLSEIELTESRA
FT                   DALRNTAFLVSQSLERIRETTRISSAGAELVTSIEEVERNVVQATGVAAEAATLTSGAN
FT                   QAVGRLAQSSNEVGDVVKVINSIAEQTNLLALNATIEAARAGDAGKGFAVVANEVKDLA
FT                   QGTARATEDVARLISAIQSDASSVVTSLAEIEHIVDRINETQTMIGGVLTEQAAVTRDI
FT                   VGA"
     MPFTSNRVRA ELARALAALA EAEQDTAAVT AVVKALDGVK SSRDAAKAAL DVVRQRFGWV        60
     YGSYWQVDGT GGALRFAVES GDAGEEFRAV TREASFAEGV GLSGRAWRSR DLVFVGDLGT       120
     LRDCVRAPVA QKVGVKSGIC FPLTENGRVV GTMDFFSLEE LNPSKQRLEV LRSIGLLVAQ       180
     AMERVVDVER QAASALDIQA VNAVLRGLGS ATSEEEATRQ ALDTVRSEFG WAYGSFWAVD       240
     PTGQELRYVT ESGDAGEEFR KITREASFRQ GVGLAGRAWK SREMLFVPDL ADMTDCVRAP       300
     AARRVGVKSG VCLPLVVHGA VVGTMDFFSL SEIELTESRA DALRNTAFLV SQSLERIRET       360
     TRISSAGAEL VTSIEEVERN VVQATGVAAE AATLTSGANQ AVGRLAQSSN EVGDVVKVIN       420
     SIAEQTNLLA LNATIEAARA GDAGKGFAVV ANEVKDLAQG TARATEDVAR LISAIQSDAS       480
     SVVTSLAEIE HIVDRINETQ TMIGGVLTEQ AAVTRDIVGA                             520
//

If you have problems or comments...

PBIL Back to PBIL home page