(data stored in ACNUC7421 zone)

EMBL: CP001630.PE37

CP001630.PE37        Location/Qualifiers
FT   CDS             41233..42615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0037"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; Tetratricopeptide domain
FT                   protein; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34011"
FT                   /db_xref="GOA:C6WCJ0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCJ0"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACU34011.1"
FT                   /translation="MNTIGSSNSPVTPEVWDQQEMRDALAKREISTVYRLLRRHGVSQR
FT                   QIAALTGQSQSEVSEILKGRQVMAYDVLTRIANGLGVPRGYMGLAYDEATAVRVAATAE
FT                   APHSEEDESVKRRKFLAHAAAITVGAAVFGTDSGSWTGSPAQTPAPGRIGMTDVRQVEA
FT                   ATKALRTLDYQYGGGSCRDAVVAQLSWGQQMLGANATELVKEWLFVALADLHNLAGWTS
FT                   FDTGLYDSARNHFGQALSLAKQGRKEELVANILYRMGRVYLHQDAPDDALKVFQLGQLA
FT                   AQNSGSELAVGILCANEAWAYAKMGSDTQALKLLGRARDEFARANVAEAPAWARFFDAN
FT                   DLSAMVGTVHTELAQTVDVKYTRTAIPALSKAIGGYGEDMTRSKSFNFISLSINHLLQG
FT                   DLDHGSKVGRQALDLSESLKSIRTKDRMKPLLGEAQKRRNNQDARELAERVSKFTGTDS
FT                   AA"
     MNTIGSSNSP VTPEVWDQQE MRDALAKREI STVYRLLRRH GVSQRQIAAL TGQSQSEVSE        60
     ILKGRQVMAY DVLTRIANGL GVPRGYMGLA YDEATAVRVA ATAEAPHSEE DESVKRRKFL       120
     AHAAAITVGA AVFGTDSGSW TGSPAQTPAP GRIGMTDVRQ VEAATKALRT LDYQYGGGSC       180
     RDAVVAQLSW GQQMLGANAT ELVKEWLFVA LADLHNLAGW TSFDTGLYDS ARNHFGQALS       240
     LAKQGRKEEL VANILYRMGR VYLHQDAPDD ALKVFQLGQL AAQNSGSELA VGILCANEAW       300
     AYAKMGSDTQ ALKLLGRARD EFARANVAEA PAWARFFDAN DLSAMVGTVH TELAQTVDVK       360
     YTRTAIPALS KAIGGYGEDM TRSKSFNFIS LSINHLLQGD LDHGSKVGRQ ALDLSESLKS       420
     IRTKDRMKPL LGEAQKRRNN QDARELAERV SKFTGTDSAA                             460
//

If you have problems or comments...

PBIL Back to PBIL home page