(data stored in ACNUC7421 zone)

EMBL: CP001630.PE370

CP001630.PE370       Location/Qualifiers
FT   CDS             complement(411724..413376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0377"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A; SMART: von
FT                   Willebrand factor type A; KEGG: mxa:MXAN_6334 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34344"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGM8"
FT                   /inference="protein motif:PFAM:PF00092"
FT                   /protein_id="ACU34344.1"
FT                   /translation="MAVPRRTTAAVALAAAALAAAPHAVAHAAPPAERVEQVAAAAPAA
FT                   SRCGPMDVVFALDDTGSMGGALNNIKTSINAVVGDVVSASGGDYRLGLVTFKDSINVVT
FT                   GLAAGNAGTVTGYVTNVLAASGGGGEPEASDEALRTAVSLRPAAGIPQNADFTGPWRSN
FT                   ARKFVVLVTDARPGGFDDAFTAADQASATAVANSALAAGVKLSAVYVPTSPSMTPTIAP
FT                   IMQNYATTTSGVYVQAQADGSGTADAIRKALSDCRRTDVFMRDQTTDNGVEVNPNGSVW
FT                   ASPDIKVCPTTADCATTYQPPVGSTSWIHVRLNNPGPYGSGTGAGTLKLYWVNPSGSTV
FT                   WNEATGGDWTFIGQQAATVPAGTTVVKVPWTNVPGPGHFCLLARWVSANDPMTHVEGAN
FT                   TAQNAKNNNNIAWRNVDTVRVRPTVPGRTSFTLGNAVEKEIRTDLLFTSPGKPFVGAGK
FT                   VVVDLGRELFERWQASGGQARGIERVGESAVQVLDPKQAALIGIAVRPGERFTAGLEFH
FT                   GGEPGGEYLLHVVQRLGDEELGGVAYQVLVEKE"
     MAVPRRTTAA VALAAAALAA APHAVAHAAP PAERVEQVAA AAPAASRCGP MDVVFALDDT        60
     GSMGGALNNI KTSINAVVGD VVSASGGDYR LGLVTFKDSI NVVTGLAAGN AGTVTGYVTN       120
     VLAASGGGGE PEASDEALRT AVSLRPAAGI PQNADFTGPW RSNARKFVVL VTDARPGGFD       180
     DAFTAADQAS ATAVANSALA AGVKLSAVYV PTSPSMTPTI APIMQNYATT TSGVYVQAQA       240
     DGSGTADAIR KALSDCRRTD VFMRDQTTDN GVEVNPNGSV WASPDIKVCP TTADCATTYQ       300
     PPVGSTSWIH VRLNNPGPYG SGTGAGTLKL YWVNPSGSTV WNEATGGDWT FIGQQAATVP       360
     AGTTVVKVPW TNVPGPGHFC LLARWVSAND PMTHVEGANT AQNAKNNNNI AWRNVDTVRV       420
     RPTVPGRTSF TLGNAVEKEI RTDLLFTSPG KPFVGAGKVV VDLGRELFER WQASGGQARG       480
     IERVGESAVQ VLDPKQAALI GIAVRPGERF TAGLEFHGGE PGGEYLLHVV QRLGDEELGG       540
     VAYQVLVEKE                                                              550
//

If you have problems or comments...

PBIL Back to PBIL home page