(data stored in ACNUC7421 zone)

EMBL: CP001630.PE371

CP001630.PE371       Location/Qualifiers
FT   CDS             complement(413875..415284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0378"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein; KEGG:
FT                   gbm:Gbem_2673 heavy metal sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34345"
FT                   /db_xref="GOA:C6WGM9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGM9"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACU34345.1"
FT                   /translation="MRELVTGRRMRLGTRLALGLGALALAVFGLVGALVVTSMEDYLAR
FT                   KLDAQMKSTQIAQEKDFKENGDVLGPVYGWYYAVYEVRDGVAAPLPTHKLPDDDRPMAK
FT                   VATLVTGSQPVFKTVHFEGEGTYRVRGCPAGNGTVLVSAAPMDDLTTTVQQLTMVLVAL
FT                   FALALVALVVVGRAVLRRGLQPLSEMARTAHDITSHDLTDSARLPVRSEGSYGGVEVAE
FT                   LRTAFNTMLEHIDSSLAARTAAEQRLRRFIADASHELRTPLTSIRGYADLFRYAAANAP
FT                   EEREAHLEKLRAEAARMSVLLEELLLLARLDSAEAELPVRPENGDLVELVGQAVDAFRV
FT                   ARPGHPVALAVAHPRVPMRFDAGRLRQVLDNLLTNAAVHTPKGTAVSVSVDVVGGDAVV
FT                   RVSDSGPGIPARDQERIFDRFYRVDHSRTRDRGGSGLGLAVARSLVEAHRGRLDLESRP
FT                   GSTTFTITLPR"
     MRELVTGRRM RLGTRLALGL GALALAVFGL VGALVVTSME DYLARKLDAQ MKSTQIAQEK        60
     DFKENGDVLG PVYGWYYAVY EVRDGVAAPL PTHKLPDDDR PMAKVATLVT GSQPVFKTVH       120
     FEGEGTYRVR GCPAGNGTVL VSAAPMDDLT TTVQQLTMVL VALFALALVA LVVVGRAVLR       180
     RGLQPLSEMA RTAHDITSHD LTDSARLPVR SEGSYGGVEV AELRTAFNTM LEHIDSSLAA       240
     RTAAEQRLRR FIADASHELR TPLTSIRGYA DLFRYAAANA PEEREAHLEK LRAEAARMSV       300
     LLEELLLLAR LDSAEAELPV RPENGDLVEL VGQAVDAFRV ARPGHPVALA VAHPRVPMRF       360
     DAGRLRQVLD NLLTNAAVHT PKGTAVSVSV DVVGGDAVVR VSDSGPGIPA RDQERIFDRF       420
     YRVDHSRTRD RGGSGLGLAV ARSLVEAHRG RLDLESRPGS TTFTITLPR                   469
//

If you have problems or comments...

PBIL Back to PBIL home page