(data stored in ACNUC7421 zone)

EMBL: CP001630.PE372

CP001630.PE372       Location/Qualifiers
FT   CDS             complement(415284..415985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0379"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: bat:BAS2056 DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34346"
FT                   /db_xref="GOA:C6WGN0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGN0"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACU34346.1"
FT                   /translation="MENGSPVRLLVVDDEPHIADLVATVARYEGWQAVTAGSGEAAIRA
FT                   ALDFQPDIVVLDLMLPDVDGFTVLDRLRGEGAMVPVVFLTARDGTADRVAGLTRGGDDY
FT                   LVKPFSVEELMARLRAVLRRSTGPSWKRSVLKVADLVLDEDTREVRRGDRLVTLTPTEY
FT                   ELLRYLMRRSPTVLTKAQILDHVWEYDFGGRSNVVELVVSHLRRKLDVEGDEPLIHTVR
FT                   GVGYVLRRAPS"
     MENGSPVRLL VVDDEPHIAD LVATVARYEG WQAVTAGSGE AAIRAALDFQ PDIVVLDLML        60
     PDVDGFTVLD RLRGEGAMVP VVFLTARDGT ADRVAGLTRG GDDYLVKPFS VEELMARLRA       120
     VLRRSTGPSW KRSVLKVADL VLDEDTREVR RGDRLVTLTP TEYELLRYLM RRSPTVLTKA       180
     QILDHVWEYD FGGRSNVVEL VVSHLRRKLD VEGDEPLIHT VRGVGYVLRR APS              233
//

If you have problems or comments...

PBIL Back to PBIL home page