(data stored in ACNUC7421 zone)

EMBL: CP001630.PE373

CP001630.PE373       Location/Qualifiers
FT   CDS             416139..417482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0380"
FT                   /product="Ferric reductase domain protein transmembrane
FT                   component domain"
FT                   /note="PFAM: Ferric reductase domain protein transmembrane
FT                   component domain; oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein;
FT                   FAD-binding 8 domain protein; KEGG: ank:AnaeK_0310
FT                   oxidoreductase FAD/NAD(P)- binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34347"
FT                   /db_xref="GOA:C6WGN1"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGN1"
FT                   /inference="protein motif:PFAM:PF01794"
FT                   /protein_id="ACU34347.1"
FT                   /translation="MTTLQAQAPAVRPRAAARTGLHAVLGANAAVVAVLFAQAGFGSNA
FT                   LILLGRLTGLYAALVLAFQLLLVARLPWFDRRLGMDRLTAWHRVTGISVVWLLVAHVVF
FT                   ITTGYAQLASLPPLDELVHLATTVEGVLRAVVAVVLVLVVGGASARWARRRLAYETWHF
FT                   IHLYAYLAVVLAFSHQVAAGTTFTSSPLATAYWWALWGAALAAVLVGRVGLPLWRNLRH
FT                   RLRVAAVVPESDDVVSIHITGRDLDKLPARAGQFFLWRFLERGRWWQANPFSLSAAPDG
FT                   RSLRLTAKALGAGSASLRSLKPGTRVFAEGPYGAFTALHRTRPNALLIAGGVGVTPVRA
FT                   LLEEIGGHAVVVYRVSERRDAVLLDELRGLARAKGAVLHVVTGATADHAPDAQPLGARA
FT                   LGAAVPDVRERDVFVCGPSRMTDAVLASLRELGVPANQVHAERFTLAR"
     MTTLQAQAPA VRPRAAARTG LHAVLGANAA VVAVLFAQAG FGSNALILLG RLTGLYAALV        60
     LAFQLLLVAR LPWFDRRLGM DRLTAWHRVT GISVVWLLVA HVVFITTGYA QLASLPPLDE       120
     LVHLATTVEG VLRAVVAVVL VLVVGGASAR WARRRLAYET WHFIHLYAYL AVVLAFSHQV       180
     AAGTTFTSSP LATAYWWALW GAALAAVLVG RVGLPLWRNL RHRLRVAAVV PESDDVVSIH       240
     ITGRDLDKLP ARAGQFFLWR FLERGRWWQA NPFSLSAAPD GRSLRLTAKA LGAGSASLRS       300
     LKPGTRVFAE GPYGAFTALH RTRPNALLIA GGVGVTPVRA LLEEIGGHAV VVYRVSERRD       360
     AVLLDELRGL ARAKGAVLHV VTGATADHAP DAQPLGARAL GAAVPDVRER DVFVCGPSRM       420
     TDAVLASLRE LGVPANQVHA ERFTLAR                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page