(data stored in ACNUC7421 zone)

EMBL: CP001630.PE374

CP001630.PE374       Location/Qualifiers
FT   CDS             417520..417927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0381"
FT                   /product="FMN-binding domain protein"
FT                   /note="PFAM: FMN-binding domain protein; KEGG: mlo:mll6621
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34348"
FT                   /db_xref="GOA:C6WGN2"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGN2"
FT                   /inference="protein motif:PFAM:PF04205"
FT                   /protein_id="ACU34348.1"
FT                   /translation="MKRAIPVLLLTIAGLVPLWRYEPRAETTTVAAAEVPADSGAGSGS
FT                   GSTAAGRVVAGEVQETRYGQVQVQLTYEGDRITAVTMLKQPGSAPTRQAVPVLVEETLE
FT                   AQSAEVDSVSGATTTSAAYVRSLQSAIDSAE"
     MKRAIPVLLL TIAGLVPLWR YEPRAETTTV AAAEVPADSG AGSGSGSTAA GRVVAGEVQE        60
     TRYGQVQVQL TYEGDRITAV TMLKQPGSAP TRQAVPVLVE ETLEAQSAEV DSVSGATTTS       120
     AAYVRSLQSA IDSAE                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page