(data stored in ACNUC7421 zone)

EMBL: CP001630.PE375

CP001630.PE375       Location/Qualifiers
FT   CDS             417932..418645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0382"
FT                   /product="ApbE family lipoprotein"
FT                   /note="PFAM: ApbE family lipoprotein; KEGG: mlo:mll6620
FT                   thiamine biosynthesis lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34349"
FT                   /db_xref="GOA:C6WGN3"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGN3"
FT                   /inference="protein motif:PFAM:PF02424"
FT                   /protein_id="ACU34349.1"
FT                   /translation="MRHVEQVMGFPVSVNVPDGDGHGAAVADVFEWLHEVDARFSPFKP
FT                   GSEVSRLGRGEDVEPSPDLAHVLAVSEWYREATGGAFAVRRGGVLDPCAVVKGWAVERA
FT                   ADLLRSAGVPRFVLNAGGDVATEGGPWRVGVRHPDHPDRFCAVLEVDGLAVATSARYER
FT                   GDHIVDARTGEPVTSLLSLTVVARSLEVADATATAAFALGREGVAWAASRPGCEVHAVD
FT                   ADRRVHRTPGLPLAP"
     MRHVEQVMGF PVSVNVPDGD GHGAAVADVF EWLHEVDARF SPFKPGSEVS RLGRGEDVEP        60
     SPDLAHVLAV SEWYREATGG AFAVRRGGVL DPCAVVKGWA VERAADLLRS AGVPRFVLNA       120
     GGDVATEGGP WRVGVRHPDH PDRFCAVLEV DGLAVATSAR YERGDHIVDA RTGEPVTSLL       180
     SLTVVARSLE VADATATAAF ALGREGVAWA ASRPGCEVHA VDADRRVHRT PGLPLAP          237
//

If you have problems or comments...

PBIL Back to PBIL home page