(data stored in ACNUC7421 zone)

EMBL: CP001630.PE377

CP001630.PE377       Location/Qualifiers
FT   CDS             complement(419414..420451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0384"
FT                   /product="ADP-ribosylation/Crystallin J1"
FT                   /note="PFAM: ADP-ribosylation/Crystallin J1; KEGG:
FT                   dol:Dole_0265 ADP-ribosylation/crystallin J1"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34351"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGN5"
FT                   /inference="protein motif:PFAM:PF03747"
FT                   /protein_id="ACU34351.1"
FT                   /translation="MPREPMAVVDRGAACLLGGALGDALGAPVQYLGLPDIQRDHGPDG
FT                   VLEPPWPALVTDDTQLTLFSADGYLRAWVRGKRTGEWEPVDEVWNSYRRWLVTQQFAAP
FT                   DEGATGLLAQGRLYASRSPGLTCLRALAADVPPTPEAPINESSGCNGVTRTAPAGFAPH
FT                   PDIAYDLGCRFAALTHGGTGGWVSGGAFALLIHLLAVRGRPLREAVDQVIGRVLRDDPY
FT                   TANALNRAVVYAEEQRATGGPVRVDRLGSGWTGPEALAIAVHTVLVYPKRSQVVDALRT
FT                   AANHSGGSDATASLTGNILGALHGTAGLPREWLAGLELVDVLAALGADLGCSVSGLEFD
FT                   ESLYA"
     MPREPMAVVD RGAACLLGGA LGDALGAPVQ YLGLPDIQRD HGPDGVLEPP WPALVTDDTQ        60
     LTLFSADGYL RAWVRGKRTG EWEPVDEVWN SYRRWLVTQQ FAAPDEGATG LLAQGRLYAS       120
     RSPGLTCLRA LAADVPPTPE APINESSGCN GVTRTAPAGF APHPDIAYDL GCRFAALTHG       180
     GTGGWVSGGA FALLIHLLAV RGRPLREAVD QVIGRVLRDD PYTANALNRA VVYAEEQRAT       240
     GGPVRVDRLG SGWTGPEALA IAVHTVLVYP KRSQVVDALR TAANHSGGSD ATASLTGNIL       300
     GALHGTAGLP REWLAGLELV DVLAALGADL GCSVSGLEFD ESLYA                       345
//

If you have problems or comments...

PBIL Back to PBIL home page