(data stored in ACNUC7421 zone)

EMBL: CP001630.PE378

CP001630.PE378       Location/Qualifiers
FT   CDS             420623..423445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0385"
FT                   /product="transcriptional regulator, SARP family"
FT                   /note="PFAM: transcriptional activator domain; NB-ARC
FT                   domain protein; transcriptional regulator domain protein;
FT                   KEGG: scl:sce8759 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34352"
FT                   /db_xref="GOA:C6WGN6"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGN6"
FT                   /inference="protein motif:PFAM:PF03704"
FT                   /protein_id="ACU34352.1"
FT                   /translation="MGDRSRCGLEFGVLGPLRVVADGGPIAIGRRGVRALLAVLVLEAN
FT                   RVVPIDELVDRLWGDEPPATARTIVHGYVSRLRKVLDAADPAGSARILTTPPGYQLAVD
FT                   PWRLDHHRARRLISSARGKPATSRAPLLRDALRLWRGPVLADVPNAPGSDLAELRLVAL
FT                   EERAAAELELGHHLEVVGELRQLVAEHPFRERLVAQAVLALYRSGRRADALDAYQRFHR
FT                   RLVDELGIDPGPDLRALHERVLRDDPALLPARAPETPGVAPRPGVVVPAQLPAAASGFV
FT                   GRDEELAWLDRLCDTRDRDATTTAVLDGPPGIGKSELAVAWGHRRAAQFPDGLLFAQLG
FT                   GHADDERARVGPDEVLARFLLALGVPADAVPRGTADRVGLYRSVLAGRRVLVVLDDARD
FT                   AEHVRLLLPPGSGSLALVTSRLRLGSLVVSAGARVLTLDVLAEDESARLVDEAVGKPLS
FT                   EQEPDAVRDLARLCGNLPLALRIAAARLVSSPEWAVASLVDALADDSTRLRALDLADAD
FT                   AGGGVGVARALALSYRELPDELAEVFRAAGLVPGRRVTAQAVAALCRTDAGTAARRLAE
FT                   LADAHLLLERGRGDYALHDLVRLYARELLADVPPERTAAALGRLLDHYLAACDRARRLL
FT                   RPATDGLDPGQSDHRAARPATSGQALLWFDKEWPNIVALARAGAERGLHRRVWQLVRLV
FT                   HTRCAVRAVDDGWSELAAIGLASARAEGDPRGEVLVLHAAHSVALRTGPAPGPLADARR
FT                   AHRIAEGLGEARYLVLALDQLASALLATGETGAAITRYREAVEAARRDGDVLGEAHVLN
FT                   NLAQAEQAAGRRETAARHQFQAAELFHRTGDQRGHALAVGNLAELYAELDLLVEAEESA
FT                   RQAVQLAVGGTMRYEEAFGRQVLGAVLARRGERSAARAELVESLRLFERLGSPRAASVR
FT                   IALDGLGGVF"
     MGDRSRCGLE FGVLGPLRVV ADGGPIAIGR RGVRALLAVL VLEANRVVPI DELVDRLWGD        60
     EPPATARTIV HGYVSRLRKV LDAADPAGSA RILTTPPGYQ LAVDPWRLDH HRARRLISSA       120
     RGKPATSRAP LLRDALRLWR GPVLADVPNA PGSDLAELRL VALEERAAAE LELGHHLEVV       180
     GELRQLVAEH PFRERLVAQA VLALYRSGRR ADALDAYQRF HRRLVDELGI DPGPDLRALH       240
     ERVLRDDPAL LPARAPETPG VAPRPGVVVP AQLPAAASGF VGRDEELAWL DRLCDTRDRD       300
     ATTTAVLDGP PGIGKSELAV AWGHRRAAQF PDGLLFAQLG GHADDERARV GPDEVLARFL       360
     LALGVPADAV PRGTADRVGL YRSVLAGRRV LVVLDDARDA EHVRLLLPPG SGSLALVTSR       420
     LRLGSLVVSA GARVLTLDVL AEDESARLVD EAVGKPLSEQ EPDAVRDLAR LCGNLPLALR       480
     IAAARLVSSP EWAVASLVDA LADDSTRLRA LDLADADAGG GVGVARALAL SYRELPDELA       540
     EVFRAAGLVP GRRVTAQAVA ALCRTDAGTA ARRLAELADA HLLLERGRGD YALHDLVRLY       600
     ARELLADVPP ERTAAALGRL LDHYLAACDR ARRLLRPATD GLDPGQSDHR AARPATSGQA       660
     LLWFDKEWPN IVALARAGAE RGLHRRVWQL VRLVHTRCAV RAVDDGWSEL AAIGLASARA       720
     EGDPRGEVLV LHAAHSVALR TGPAPGPLAD ARRAHRIAEG LGEARYLVLA LDQLASALLA       780
     TGETGAAITR YREAVEAARR DGDVLGEAHV LNNLAQAEQA AGRRETAARH QFQAAELFHR       840
     TGDQRGHALA VGNLAELYAE LDLLVEAEES ARQAVQLAVG GTMRYEEAFG RQVLGAVLAR       900
     RGERSAARAE LVESLRLFER LGSPRAASVR IALDGLGGVF                             940
//

If you have problems or comments...

PBIL Back to PBIL home page