(data stored in ACNUC7421 zone)

EMBL: CP001630.PE379

CP001630.PE379       Location/Qualifiers
FT   CDS             complement(423636..424412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0386"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="PFAM: lipolytic protein G-D-S-L family; KEGG:
FT                   bcb:BCB4264_A2458 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34353"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGN7"
FT                   /inference="protein motif:PFAM:PF00657"
FT                   /protein_id="ACU34353.1"
FT                   /translation="MQELDSYVAVGDSFTEGLDDPAPHGGYLGWADRLAAMISSRQRGF
FT                   RYANLAIRGRLLQAIVEEQVPVAVALKPSLVTFCAGGNDLLMPGADPDAVAEVYEIAVA
FT                   ELRATGAEVVIFTGFDPRHAPVLRSLRGKVAIYNSHLWSVAERYNCKVVDLWSMTVLHD
FT                   IRAWGPDRLHLAPEGHQRVALRVAELLGHEQEEQWRTPWPVVAEDDWMTQRRQDLKWAR
FT                   EHVVPFITRHLRGASLGDGVVPKRPELLPISSGENN"
     MQELDSYVAV GDSFTEGLDD PAPHGGYLGW ADRLAAMISS RQRGFRYANL AIRGRLLQAI        60
     VEEQVPVAVA LKPSLVTFCA GGNDLLMPGA DPDAVAEVYE IAVAELRATG AEVVIFTGFD       120
     PRHAPVLRSL RGKVAIYNSH LWSVAERYNC KVVDLWSMTV LHDIRAWGPD RLHLAPEGHQ       180
     RVALRVAELL GHEQEEQWRT PWPVVAEDDW MTQRRQDLKW AREHVVPFIT RHLRGASLGD       240
     GVVPKRPELL PISSGENN                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page