(data stored in ACNUC7421 zone)

EMBL: CP001630.PE38

CP001630.PE38        Location/Qualifiers
FT   CDS             42689..43585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0038"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   bcz:BCZK4351 homoserine kinase type II (protein kinase
FT                   fold)"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34012"
FT                   /db_xref="GOA:C6WCJ1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCJ1"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ACU34012.1"
FT                   /translation="MAGGGRFTPAVLADVLERLCAGLGLDHRGARLLKFTANAVYELPA
FT                   EQVVVRITGSMALRHRAPKVVAVARWLARHDVPAVRLVEDVPQPLVVGEHVATLWRTAP
FT                   SGGPPVDGRDLGRLLRLVHSLPEPDFAVPKWSPLEDVRRRIADAEELAADDLEFLEERC
FT                   AALAERLRSLETALPVGLVHGDAHLRNLIPSPDGPLICDFDSTGLGPREWDLSMVPVGA
FT                   ARLGHPWRWHEQLAAEYGFDVTGWPGYALLRDVRELKLTTSVLPILRSHPEVAPELRRR
FT                   LRSLREGDSGTRWEPYR"
     MAGGGRFTPA VLADVLERLC AGLGLDHRGA RLLKFTANAV YELPAEQVVV RITGSMALRH        60
     RAPKVVAVAR WLARHDVPAV RLVEDVPQPL VVGEHVATLW RTAPSGGPPV DGRDLGRLLR       120
     LVHSLPEPDF AVPKWSPLED VRRRIADAEE LAADDLEFLE ERCAALAERL RSLETALPVG       180
     LVHGDAHLRN LIPSPDGPLI CDFDSTGLGP REWDLSMVPV GAARLGHPWR WHEQLAAEYG       240
     FDVTGWPGYA LLRDVRELKL TTSVLPILRS HPEVAPELRR RLRSLREGDS GTRWEPYR         298
//

If you have problems or comments...

PBIL Back to PBIL home page