(data stored in ACNUC7421 zone)

EMBL: CP001630.PE381

CP001630.PE381       Location/Qualifiers
FT   CDS             425108..425854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34355"
FT                   /db_xref="GOA:C6WGN9"
FT                   /db_xref="InterPro:IPR016566"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGN9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34355.1"
FT                   /translation="MHPGSMTDTRQESLAELLGGRSGALDASLPPAVFALGWLLGERSI
FT                   GAGALAAVLCGVVIGAYRLARGGKPRAVVVSLTLVVLAAYVALRTGRAEDFFLLRILLN
FT                   VGSALVWAASIVLRWPLLGVVVGLVTGQKLKWRKDPDLMRAYRYASWPWVGQYLLRVAV
FT                   FGGFWLAGQVVALGVAQVALSWPLQVVCVVVSWWVIRRSLPADHPGLRHPRVPGEPAEP
FT                   AQAAGPAVENPAPATGSAVEKPERVD"
     MHPGSMTDTR QESLAELLGG RSGALDASLP PAVFALGWLL GERSIGAGAL AAVLCGVVIG        60
     AYRLARGGKP RAVVVSLTLV VLAAYVALRT GRAEDFFLLR ILLNVGSALV WAASIVLRWP       120
     LLGVVVGLVT GQKLKWRKDP DLMRAYRYAS WPWVGQYLLR VAVFGGFWLA GQVVALGVAQ       180
     VALSWPLQVV CVVVSWWVIR RSLPADHPGL RHPRVPGEPA EPAQAAGPAV ENPAPATGSA       240
     VEKPERVD                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page