(data stored in ACNUC7421 zone)

EMBL: CP001630.PE382

CP001630.PE382       Location/Qualifiers
FT   CDS             complement(425911..426903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0389"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   sme:SM_b21003 putative oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34356"
FT                   /db_xref="GOA:C6WGP0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGP0"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ACU34356.1"
FT                   /translation="MELGIYSFGDLAPRSGGEPADVARRLADLVDQVRTADGAGLDVVA
FT                   IGEHHRREFTVSAPEIVLAALAGVTSSIRLASGVTVLSTQDPVRVFQQFATLDQLSGGR
FT                   AEVIVGRGAFTESFPLFGHDLRDYDELFDTKVKALLELTRSRELPVVNGVDVVPRPLQP
FT                   ELPVWIGVGGTPQSAIRAGVLGTPMFLAFFTGPETSRGTAELYRRAGEQAGHDPASLRL
FT                   ASGGHMFVGRTSQGAKDDFYPYYSDYFSLHPRMRDGMPRGVYDEWLRAGLLVGSPQEVV
FT                   DKILRHREVLGVDRYVGQFDVGGMPVAMTNRSLELFLTEVVPAVRAETA"
     MELGIYSFGD LAPRSGGEPA DVARRLADLV DQVRTADGAG LDVVAIGEHH RREFTVSAPE        60
     IVLAALAGVT SSIRLASGVT VLSTQDPVRV FQQFATLDQL SGGRAEVIVG RGAFTESFPL       120
     FGHDLRDYDE LFDTKVKALL ELTRSRELPV VNGVDVVPRP LQPELPVWIG VGGTPQSAIR       180
     AGVLGTPMFL AFFTGPETSR GTAELYRRAG EQAGHDPASL RLASGGHMFV GRTSQGAKDD       240
     FYPYYSDYFS LHPRMRDGMP RGVYDEWLRA GLLVGSPQEV VDKILRHREV LGVDRYVGQF       300
     DVGGMPVAMT NRSLELFLTE VVPAVRAETA                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page