(data stored in ACNUC7421 zone)

EMBL: CP001630.PE383

CP001630.PE383       Location/Qualifiers
FT   CDS             427020..427901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0390"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: acr:Acry_2830 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34357"
FT                   /db_xref="GOA:C6WGP1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGP1"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACU34357.1"
FT                   /translation="MELRHLKHFVALAEESSFTRAAERELIVQSGLSSSIRSLERDVGS
FT                   ELFVRGSRPVRLTAAGRALLPGARRTLQESERAKQLVRDVRGLVAGPFTIGTLPLHNRD
FT                   VSCRFVNWLASFATAHPGLDISVRQPGRDRALALVAEGGLDCAVVTGAPARLPGLRATR
FT                   LSTQPVVALLASGHPLAGRDGLALADLAGERFVDTYPGHESRDLVDLAFAERGLTRRIS
FT                   CEVVDLPMVFNLTRAGLGVALVPARTDLPAEGVVAVPLREEGLVHTVDLVLPKDPATSP
FT                   AAAAFAAHVAAG"
     MELRHLKHFV ALAEESSFTR AAERELIVQS GLSSSIRSLE RDVGSELFVR GSRPVRLTAA        60
     GRALLPGARR TLQESERAKQ LVRDVRGLVA GPFTIGTLPL HNRDVSCRFV NWLASFATAH       120
     PGLDISVRQP GRDRALALVA EGGLDCAVVT GAPARLPGLR ATRLSTQPVV ALLASGHPLA       180
     GRDGLALADL AGERFVDTYP GHESRDLVDL AFAERGLTRR ISCEVVDLPM VFNLTRAGLG       240
     VALVPARTDL PAEGVVAVPL REEGLVHTVD LVLPKDPATS PAAAAFAAHV AAG              293
//

If you have problems or comments...

PBIL Back to PBIL home page