(data stored in ACNUC7421 zone)

EMBL: CP001630.PE384

CP001630.PE384       Location/Qualifiers
FT   CDS             complement(428065..429006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0391"
FT                   /product="ATPase BadF/BadG/BcrA/BcrD type"
FT                   /note="PFAM: ATPase BadF/BadG/BcrA/BcrD type; KEGG:
FT                   slo:Shew_1116 ATPase, BadF/BadG/BcrA/BcrD type"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34358"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGP2"
FT                   /inference="protein motif:PFAM:PF01869"
FT                   /protein_id="ACU34358.1"
FT                   /translation="MSFVVGVDGGGTSTRALVVGADGTRLGAGVAGGSNPNSVGSGTAA
FT                   ANLRLALEGALSGVDAGAVVAGVLGMAGSSKLTDPGVDALFRAAWAGAGLRCPMRVVTD
FT                   CEAAFAAGTPAPDGTVLVAGTGSIAARVRGRRVVGTVGGHGWLLGDEGSAFWLGREAVR
FT                   AALRALEAGELDGLARAVLERAGVDEGPGAWARLITAANAGPPVALAGYAPLVTAAAGA
FT                   PGEVVAARIVDGCARVLADLAAAARTAEEVAPVVLVGSLVGAPVLGERLRAELAARVDG
FT                   EVVVVREAAVGAAWLAALESGVEDGWRERALG"
     MSFVVGVDGG GTSTRALVVG ADGTRLGAGV AGGSNPNSVG SGTAAANLRL ALEGALSGVD        60
     AGAVVAGVLG MAGSSKLTDP GVDALFRAAW AGAGLRCPMR VVTDCEAAFA AGTPAPDGTV       120
     LVAGTGSIAA RVRGRRVVGT VGGHGWLLGD EGSAFWLGRE AVRAALRALE AGELDGLARA       180
     VLERAGVDEG PGAWARLITA ANAGPPVALA GYAPLVTAAA GAPGEVVAAR IVDGCARVLA       240
     DLAAAARTAE EVAPVVLVGS LVGAPVLGER LRAELAARVD GEVVVVREAA VGAAWLAALE       300
     SGVEDGWRER ALG                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page