(data stored in ACNUC7421 zone)

EMBL: CP001630.PE385

CP001630.PE385       Location/Qualifiers
FT   CDS             complement(429003..432230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0392"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; KEGG: glo:Glov_1721 peptidase S8 and S53
FT                   subtilisin kexin sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34359"
FT                   /db_xref="GOA:C6WGP3"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034213"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGP3"
FT                   /inference="protein motif:PFAM:PF00082"
FT                   /protein_id="ACU34359.1"
FT                   /translation="MRLHRRAATAAALAAALAAPLAPLGHAAPDHPRPHRVTAFVELVG
FT                   VPAVDAAATARSDPREAARAARARTGNNADAVLDAVRSVDRGAARVGVTVNAVPGVVLT
FT                   AEPAVLRWVAGMPQVRSVRQAVPKRVDNAGAVRLTGAAAVWRAVGPSLPGHGGAVAGDG
FT                   LREGLRGEGLRIGVVDTGVDYTHADFGGSGGYDDVDRAGPWEPNAKVVGGYDFAGDDYD
FT                   ANDPERGTPAPDPNPVDCQGHGTHVAGTAAGYGVSADGSTFTGAHSGLSDDDLAAMRIG
FT                   PGAAPAAQVYALKVFGCEGSTNVVSQALDWALDPDGDGDPSDHLDVVNLSLGSDFGAVD
FT                   DPDSAFVRKLVRHGVVVVASAGNAGDLYDAGGSPGSTPEAVTVANTRDASVLLDGVGLP
FT                   GGSAEAGGSDEPGGSDEAGGSDGAGGGEEVLPGQYGKEFTGYADLDVELPVAPVADAGN
FT                   ADGCAPIDQDLSGRLVWLEWDDSDSTRECGSAVRADHARDAGAAGAVLSSGRTAFGAGI
FT                   AGNADVPMFQLTGPATDRVRPLLADGSLRLRLAGSLRDAAPTVVETLADTVTPSSARGS
FT                   RLAGGAKPDLAAPGDTIVSALVGSGSGGVSKGGTSMAAPHVAGLAALVRQAHPDWTVEE
FT                   VKAALVNTASARVVSGDDRTTGLTEATTRVGAGRVDARAAVRTGLLAVVPEDPGAVGVS
FT                   FGTVEAGAPVELTRTVELVNKTGEDLAAVAAYRAATEVPGAEVEVLPRTARVPAGGTAR
FT                   VSVRLRVDPAALRKVGDPTLEVEQRGHARQFLAEVSGRVVFRAGAQDAVLPVYAAPRPV
FT                   SALTARPAPGGVELVGRGLDQGEGAGAYRSLVSAFELHGRSPELPPCGSELLTGCLAAG
FT                   SARGGDLRYAGASAADGVLSFGIATWGTWTGLGAGGTTPVVGVDVDRDGAEDYRVQVAR
FT                   PSDGSGKVVADLWWARTTRVSDDEVVDERPVNGWHGEVDSAVMDSDVLALPVSLEALGV
FT                   ALGDGPVRYRVRTRGWALPAGTEDGVVDRFDGWFDVDPAGSRVALPVGSVARDGLLVPV
FT                   RGAGEVLVLHHHNGGGSRAEVVVYSGE"
     MRLHRRAATA AALAAALAAP LAPLGHAAPD HPRPHRVTAF VELVGVPAVD AAATARSDPR        60
     EAARAARART GNNADAVLDA VRSVDRGAAR VGVTVNAVPG VVLTAEPAVL RWVAGMPQVR       120
     SVRQAVPKRV DNAGAVRLTG AAAVWRAVGP SLPGHGGAVA GDGLREGLRG EGLRIGVVDT       180
     GVDYTHADFG GSGGYDDVDR AGPWEPNAKV VGGYDFAGDD YDANDPERGT PAPDPNPVDC       240
     QGHGTHVAGT AAGYGVSADG STFTGAHSGL SDDDLAAMRI GPGAAPAAQV YALKVFGCEG       300
     STNVVSQALD WALDPDGDGD PSDHLDVVNL SLGSDFGAVD DPDSAFVRKL VRHGVVVVAS       360
     AGNAGDLYDA GGSPGSTPEA VTVANTRDAS VLLDGVGLPG GSAEAGGSDE PGGSDEAGGS       420
     DGAGGGEEVL PGQYGKEFTG YADLDVELPV APVADAGNAD GCAPIDQDLS GRLVWLEWDD       480
     SDSTRECGSA VRADHARDAG AAGAVLSSGR TAFGAGIAGN ADVPMFQLTG PATDRVRPLL       540
     ADGSLRLRLA GSLRDAAPTV VETLADTVTP SSARGSRLAG GAKPDLAAPG DTIVSALVGS       600
     GSGGVSKGGT SMAAPHVAGL AALVRQAHPD WTVEEVKAAL VNTASARVVS GDDRTTGLTE       660
     ATTRVGAGRV DARAAVRTGL LAVVPEDPGA VGVSFGTVEA GAPVELTRTV ELVNKTGEDL       720
     AAVAAYRAAT EVPGAEVEVL PRTARVPAGG TARVSVRLRV DPAALRKVGD PTLEVEQRGH       780
     ARQFLAEVSG RVVFRAGAQD AVLPVYAAPR PVSALTARPA PGGVELVGRG LDQGEGAGAY       840
     RSLVSAFELH GRSPELPPCG SELLTGCLAA GSARGGDLRY AGASAADGVL SFGIATWGTW       900
     TGLGAGGTTP VVGVDVDRDG AEDYRVQVAR PSDGSGKVVA DLWWARTTRV SDDEVVDERP       960
     VNGWHGEVDS AVMDSDVLAL PVSLEALGVA LGDGPVRYRV RTRGWALPAG TEDGVVDRFD      1020
     GWFDVDPAGS RVALPVGSVA RDGLLVPVRG AGEVLVLHHH NGGGSRAEVV VYSGE           1075
//

If you have problems or comments...

PBIL Back to PBIL home page