(data stored in ACNUC7421 zone)

EMBL: CP001630.PE386

CP001630.PE386       Location/Qualifiers
FT   CDS             432351..433205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0393"
FT                   /product="5-oxopent-3-ene-1,2,5-tricarboxylatedecarboxylas
FT                   e"
FT                   /EC_number="4.1.1.68"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   rle:RL0016 putative FAA hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34360"
FT                   /db_xref="GOA:C6WGP4"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGP4"
FT                   /inference="protein motif:PRIAM:4.1.1.68"
FT                   /protein_id="ACU34360.1"
FT                   /translation="MQLMRLGEPGSERPAVRADDGTVHDLSGLTADVDGAFLASGGIAR
FT                   ARAALDQGLLPRLAVQGVRVGPPVAGIGKIVCIGLNYRDHADETGQAPPAEPVVFLKAA
FT                   DTVVGPDDEVLLPRRSVKTDWEVELGVVIGRTARYLDSAEEALDHVAGYALSHDVSERE
FT                   FQLERGGQWDKGKSCETFNPLGPFLVPADEVPDPQDLGMRLRVNGLLRQDSSTRRMIFP
FT                   VAELVRYLSWFVVLRPGDLINTGTPAGVALGLPEPKPYLREGDVVELEIDGLGAQRQRV
FT                   GQA"
     MQLMRLGEPG SERPAVRADD GTVHDLSGLT ADVDGAFLAS GGIARARAAL DQGLLPRLAV        60
     QGVRVGPPVA GIGKIVCIGL NYRDHADETG QAPPAEPVVF LKAADTVVGP DDEVLLPRRS       120
     VKTDWEVELG VVIGRTARYL DSAEEALDHV AGYALSHDVS EREFQLERGG QWDKGKSCET       180
     FNPLGPFLVP ADEVPDPQDL GMRLRVNGLL RQDSSTRRMI FPVAELVRYL SWFVVLRPGD       240
     LINTGTPAGV ALGLPEPKPY LREGDVVELE IDGLGAQRQR VGQA                        284
//

If you have problems or comments...

PBIL Back to PBIL home page