(data stored in ACNUC7421 zone)

EMBL: CP001630.PE388

CP001630.PE388       Location/Qualifiers
FT   CDS             434593..435363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0395"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; NAD-dependent epimerase/dehydratase; KEGG:
FT                   bpe:BP1923 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34362"
FT                   /db_xref="GOA:C6WGP6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGP6"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACU34362.1"
FT                   /translation="MGGDGGAVNDFDGLVAAVTGGASGIGLATARLLAGRGAVVYALDL
FT                   DPEVPEPLRGLRTDVADDASVRAALAELTAETGRLDVLVANAGIGAQGDVAAADDAEWL
FT                   RVLDVNVVGVARVVRAALPHLRRSPSAAVVTTGSIAAHAGLPQRAVYSASKGAVHALTL
FT                   AMAADHLREGVRFNAVAPGTADTPWVGRLLASAPDPVAERAALEARQPHGRLVAAEEVA
FT                   AAIAHLASPLSGSTTGTVLAVDGGMHGLRLRPEP"
     MGGDGGAVND FDGLVAAVTG GASGIGLATA RLLAGRGAVV YALDLDPEVP EPLRGLRTDV        60
     ADDASVRAAL AELTAETGRL DVLVANAGIG AQGDVAAADD AEWLRVLDVN VVGVARVVRA       120
     ALPHLRRSPS AAVVTTGSIA AHAGLPQRAV YSASKGAVHA LTLAMAADHL REGVRFNAVA       180
     PGTADTPWVG RLLASAPDPV AERAALEARQ PHGRLVAAEE VAAAIAHLAS PLSGSTTGTV       240
     LAVDGGMHGL RLRPEP                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page