(data stored in ACNUC7421 zone)

EMBL: CP001630.PE389

CP001630.PE389       Location/Qualifiers
FT   CDS             435360..436289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0396"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: xac:XAC4184
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34363"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGP7"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ACU34363.1"
FT                   /translation="MTGAVTGPSRLGFGAAPLGNLYEPVADADAEAAVRAAWEAGVRYY
FT                   DTAPHYGLGLSERRLGAALAGVPRADLVLSTKVGRLLEPVDPVGDDLANGFAVPAHSRR
FT                   VWDFSADGVRRSLESSVDRLGVDRVDVVYLHDPDHHWRQAIDEAYPALADLRDQGVVRA
FT                   VGVGMNQWRVPERFVRETDVDVVLLAGRHTLLERGATGLLDLCAERGVEVVAAAPFNSG
FT                   LLAERVVPDGATHDYAPAPPELLARARALARTCAAHGVDLPAAALQFPLRHPAVRSVLV
FT                   GMRSAAQVRANAAALAAPAPDALWEELA"
     MTGAVTGPSR LGFGAAPLGN LYEPVADADA EAAVRAAWEA GVRYYDTAPH YGLGLSERRL        60
     GAALAGVPRA DLVLSTKVGR LLEPVDPVGD DLANGFAVPA HSRRVWDFSA DGVRRSLESS       120
     VDRLGVDRVD VVYLHDPDHH WRQAIDEAYP ALADLRDQGV VRAVGVGMNQ WRVPERFVRE       180
     TDVDVVLLAG RHTLLERGAT GLLDLCAERG VEVVAAAPFN SGLLAERVVP DGATHDYAPA       240
     PPELLARARA LARTCAAHGV DLPAAALQFP LRHPAVRSVL VGMRSAAQVR ANAAALAAPA       300
     PDALWEELA                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page