(data stored in ACNUC7421 zone)

EMBL: CP001630.PE39

CP001630.PE39        Location/Qualifiers
FT   CDS             43715..43996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34013"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCJ2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34013.1"
FT                   /translation="MLGTRRRRAKRALDAARMLDEVVDTQLPLLASFDEERRRRSADYL
FT                   AELVKLAQDYRYFANGWIDARELDRRGQEALVVLGKFRNDPTARLAQD"
     MLGTRRRRAK RALDAARMLD EVVDTQLPLL ASFDEERRRR SADYLAELVK LAQDYRYFAN        60
     GWIDARELDR RGQEALVVLG KFRNDPTARL AQD                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page