(data stored in ACNUC7421 zone)

EMBL: CP001630.PE390

CP001630.PE390       Location/Qualifiers
FT   CDS             436286..437110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0397"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: mes:Meso_1610
FT                   amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34364"
FT                   /db_xref="GOA:C6WGP8"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGP8"
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /protein_id="ACU34364.1"
FT                   /translation="MIVDAHHHVWDLAVRDQPWITGRMSRIRRDFTVHDLAGAAPEVTT
FT                   TVLVQTVAGPAETPELLALADREPLVGAVVGWLDLTGDVPAQLAALRSLPGARWLRGVR
FT                   HQVQVEHDPDWLIRPDVLRGLAAVAADGLVYELLTLPHQLPAARRAAAALPQLTFVLDH
FT                   CSKPPVGGDLREWAAEVRALAARPNVLCKLSGLVTEADWANWSVTDLRPVCATVLEAFG
FT                   PRRLMFGSDWPVCLLAASHAEVLAAARELTADLSAAERAALFSTTATLAYRL"
     MIVDAHHHVW DLAVRDQPWI TGRMSRIRRD FTVHDLAGAA PEVTTTVLVQ TVAGPAETPE        60
     LLALADREPL VGAVVGWLDL TGDVPAQLAA LRSLPGARWL RGVRHQVQVE HDPDWLIRPD       120
     VLRGLAAVAA DGLVYELLTL PHQLPAARRA AAALPQLTFV LDHCSKPPVG GDLREWAAEV       180
     RALAARPNVL CKLSGLVTEA DWANWSVTDL RPVCATVLEA FGPRRLMFGS DWPVCLLAAS       240
     HAEVLAAARE LTADLSAAER AALFSTTATL AYRL                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page