(data stored in ACNUC7421 zone)

EMBL: CP001630.PE391

CP001630.PE391       Location/Qualifiers
FT   CDS             437177..438277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0398"
FT                   /product="Serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="PFAM: beta-lactamase; KEGG: bcz:pE33L466_0099
FT                   D-stereospecific peptide hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34365"
FT                   /db_xref="GOA:C6WGP9"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGP9"
FT                   /inference="protein motif:PRIAM:3.4.16.4"
FT                   /protein_id="ACU34365.1"
FT                   /translation="MRTTITALAAAALLLAATAPAQAAPAVPPLNRTALAAAVAGLPDG
FT                   EASGALVRVSGRAGSWTGSGGVSRLGTTRPVSPEGRFRIGSATKLLTAAAVLRLDERGV
FT                   LDLDDTVQQHLPDLLPAAFEPITVRQLLNHTHGIAGNGLPHKSTGWFAENRYRTWDPRE
FT                   VVELGVAKGPLHRPGDEQRYGNQGYLVAGLVIEAATGRPYADSVRDLVIRPLGLRDTYL
FT                   PGAETGIRGEHSHGYQLREDGSHWDVTGANPTFQWAAAEAVSSARDLDRLINALMFGDL
FT                   IGERSRAEMLTLPLPGAAHGLGVNRIELGGVVLWGKTGDRPGYNTGVAVTEDGSRTIVY
FT                   SVNTLDMEAGELPPVAQRIITAALTP"
     MRTTITALAA AALLLAATAP AQAAPAVPPL NRTALAAAVA GLPDGEASGA LVRVSGRAGS        60
     WTGSGGVSRL GTTRPVSPEG RFRIGSATKL LTAAAVLRLD ERGVLDLDDT VQQHLPDLLP       120
     AAFEPITVRQ LLNHTHGIAG NGLPHKSTGW FAENRYRTWD PREVVELGVA KGPLHRPGDE       180
     QRYGNQGYLV AGLVIEAATG RPYADSVRDL VIRPLGLRDT YLPGAETGIR GEHSHGYQLR       240
     EDGSHWDVTG ANPTFQWAAA EAVSSARDLD RLINALMFGD LIGERSRAEM LTLPLPGAAH       300
     GLGVNRIELG GVVLWGKTGD RPGYNTGVAV TEDGSRTIVY SVNTLDMEAG ELPPVAQRII       360
     TAALTP                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page