(data stored in ACNUC7421 zone)

EMBL: CP001630.PE392

CP001630.PE392       Location/Qualifiers
FT   CDS             complement(438344..439018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0399"
FT                   /product="GntR domain protein"
FT                   /note="PFAM: GntR domain protein; regulatory protein GntR
FT                   HTH; SMART: regulatory protein GntR HTH; KEGG:
FT                   csa:Csal_0365 transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34366"
FT                   /db_xref="GOA:C6WGQ0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGQ0"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ACU34366.1"
FT                   /translation="MAVTDDAILRVREMIVSGELKPGDRLPREAVLAERLGLSRNSLRE
FT                   AVKALSLVRVLDVRQGDGTYVSSLRADELLGALSFVLDLHRGEESLLEVVQVRRILEPA
FT                   ACALAAQRVTAEDAAALRALCDAAEAAETVEELVEHDLAFHRAVAAHSGNAYLAQLLDT
FT                   LAGPTVRARIWRGIAQAGAKSRTVAEHRAIVDALAAGQPEVARSWSTVHIAGVEQWLLV
FT                   LA"
     MAVTDDAILR VREMIVSGEL KPGDRLPREA VLAERLGLSR NSLREAVKAL SLVRVLDVRQ        60
     GDGTYVSSLR ADELLGALSF VLDLHRGEES LLEVVQVRRI LEPAACALAA QRVTAEDAAA       120
     LRALCDAAEA AETVEELVEH DLAFHRAVAA HSGNAYLAQL LDTLAGPTVR ARIWRGIAQA       180
     GAKSRTVAEH RAIVDALAAG QPEVARSWST VHIAGVEQWL LVLA                        224
//

If you have problems or comments...

PBIL Back to PBIL home page