(data stored in ACNUC7421 zone)

EMBL: CP001630.PE393

CP001630.PE393       Location/Qualifiers
FT   CDS             complement(439140..440183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0400"
FT                   /product="Glutamine--fructose-6-phosphate transaminase
FT                   (isomerizing)"
FT                   /EC_number="2.6.1.16"
FT                   /note="PFAM: sugar isomerase (SIS); KEGG: sus:Acid_1598
FT                   glutamine--fructose-6-phosphate transaminase (isomerizing)"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34367"
FT                   /db_xref="GOA:C6WGQ1"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGQ1"
FT                   /inference="protein motif:PRIAM:2.6.1.16"
FT                   /protein_id="ACU34367.1"
FT                   /translation="MTEHQPGGHMAAEIDQQPAIFADLVSRRAEIAAVAEAIRGRAPRF
FT                   VLFAARGSSDHAALYAKYLTEVLLQLPAGLVSPSTTTLYGARPDLRDVLLVTVSQSGGS
FT                   PDLLEVTQSARERGALTVAVTNTPESELNGVAEMSVDVGAGVEHAVAATKTYSATLLAL
FT                   YLMVDAVRGGSGAEVAGIGELARAALDGSVDPVEEAVRRYRFVDRVLTTGRGYSLPSAL
FT                   EAALKLAETSYLAARAYSGADLLHGPVAAVDAETAVLAVTSAGLGGDALHDVLDVVHGR
FT                   GADVVAVGSAAEKAPAALRIPVPETAEEVAPILEILPVQRLAHGLALARGGDPDSPRGL
FT                   NKVTRTR"
     MTEHQPGGHM AAEIDQQPAI FADLVSRRAE IAAVAEAIRG RAPRFVLFAA RGSSDHAALY        60
     AKYLTEVLLQ LPAGLVSPST TTLYGARPDL RDVLLVTVSQ SGGSPDLLEV TQSARERGAL       120
     TVAVTNTPES ELNGVAEMSV DVGAGVEHAV AATKTYSATL LALYLMVDAV RGGSGAEVAG       180
     IGELARAALD GSVDPVEEAV RRYRFVDRVL TTGRGYSLPS ALEAALKLAE TSYLAARAYS       240
     GADLLHGPVA AVDAETAVLA VTSAGLGGDA LHDVLDVVHG RGADVVAVGS AAEKAPAALR       300
     IPVPETAEEV APILEILPVQ RLAHGLALAR GGDPDSPRGL NKVTRTR                     347
//

If you have problems or comments...

PBIL Back to PBIL home page