(data stored in ACNUC7421 zone)

EMBL: CP001630.PE394

CP001630.PE394       Location/Qualifiers
FT   CDS             complement(440530..441351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0401"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: jan:Jann_3555
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34368"
FT                   /db_xref="GOA:C6WGQ2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGQ2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACU34368.1"
FT                   /translation="MRAKRISANAVALVVALFFAFPTYWMVATALKPRKDLLSTDYDLV
FT                   PKTVTGDNFASAWNKPGFLESLGNSLLVTLSAVAAALVVGLLAALALSRMRFRGRRGFV
FT                   MMMLIAQMAPFEALLIPMFLMMRDLDLLDKLPSLTLIYFAVTLPFCAWTLRGFVNGIPL
FT                   ELEEAAMVDGCGRWGAFRRVTLPLLGPGLVATSVFAFVTAWNEFLYALSLINDQSKQTL
FT                   PVWLSGFKSNFGTDWGGAMAASALFTLPVLVFFLIVQRKMVTGVTAGAVKG"
     MRAKRISANA VALVVALFFA FPTYWMVATA LKPRKDLLST DYDLVPKTVT GDNFASAWNK        60
     PGFLESLGNS LLVTLSAVAA ALVVGLLAAL ALSRMRFRGR RGFVMMMLIA QMAPFEALLI       120
     PMFLMMRDLD LLDKLPSLTL IYFAVTLPFC AWTLRGFVNG IPLELEEAAM VDGCGRWGAF       180
     RRVTLPLLGP GLVATSVFAF VTAWNEFLYA LSLINDQSKQ TLPVWLSGFK SNFGTDWGGA       240
     MAASALFTLP VLVFFLIVQR KMVTGVTAGA VKG                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page