(data stored in ACNUC7421 zone)

EMBL: CP001630.PE395

CP001630.PE395       Location/Qualifiers
FT   CDS             complement(441348..442340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0402"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bxe:Bxe_B0419 ABC sugar
FT                   transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34369"
FT                   /db_xref="GOA:C6WGQ3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGQ3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACU34369.1"
FT                   /translation="MTAVDTTGAGASTGNVPPAPPRSAKGGGGRRRGSAFDRALPYLLL
FT                   APALVAILWLIGFPVLSVLLTSFRRLNLRELTRGQVVWTGLDNYTEVLGDPDFWLVTGR
FT                   TVAFTAAVVGASVLAGLLLAVLMRQVSPLVRIVLQVAMLLAWAMPLLAATTVYQWIFDQ
FT                   EYGILNKTLVQLGFDSYAGYSWFSTGLSTLGVVGLMITWQAVPFLAFSLYAGLIGIPRD
FT                   QYEAAGIDGASPWQTFRAVTWPELRPLLMMVTFLSVLWDFKVFAQIWAFRQGGPDGAST
FT                   TLAVYQYLVGISQSHFGVAAAVSVVMMLLLAAVTFQYLRRLVRSQEGEL"
     MTAVDTTGAG ASTGNVPPAP PRSAKGGGGR RRGSAFDRAL PYLLLAPALV AILWLIGFPV        60
     LSVLLTSFRR LNLRELTRGQ VVWTGLDNYT EVLGDPDFWL VTGRTVAFTA AVVGASVLAG       120
     LLLAVLMRQV SPLVRIVLQV AMLLAWAMPL LAATTVYQWI FDQEYGILNK TLVQLGFDSY       180
     AGYSWFSTGL STLGVVGLMI TWQAVPFLAF SLYAGLIGIP RDQYEAAGID GASPWQTFRA       240
     VTWPELRPLL MMVTFLSVLW DFKVFAQIWA FRQGGPDGAS TTLAVYQYLV GISQSHFGVA       300
     AAVSVVMMLL LAAVTFQYLR RLVRSQEGEL                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page