(data stored in ACNUC7421 zone)

EMBL: CP001630.PE396

CP001630.PE396       Location/Qualifiers
FT   CDS             complement(442348..443628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0403"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: mlo:mll4149 sugar ABC transporter, (sugar- binding
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34370"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGQ4"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACU34370.1"
FT                   /translation="MKGWRGLAVGATALSVALAGCGTSSDSGSGEGGDKTLTVWLMDGS
FT                   AAPALTDALHQEFESAHPGVKVKYEVQKWGGIQEKLTTALTGKTPPDVIELGNTQTAKF
FT                   ASEDTLEDLSGDVSSLAGDQWLAGLEDSLTWDGKQYGMPFYAANRTVVYRTDLFQAAGI
FT                   TAAPTSRDEWVAAVEKLKAANASDPEFQSLYLPGQSWYVLLSFIWDEGGDVAKKDGDKW
FT                   AGALDSAEAKAGLEFYKKLVDASGTKAPKDTDEATPQQMEVFGTGKVGMMIGLPWELAG
FT                   AVKADPTLEGKLGAFPIPSKTAGKTAPVFLGGSNLAIPAGSANPDLAKDYLKLLSSKKY
FT                   QDLLAEGGSVPGTSTDTTKLETTPVGKALAAAAPNGKVTPTTPTWAGVEAGQNPLKDML
FT                   TAYLTGAKSLDQATADANAALTKTLAG"
     MKGWRGLAVG ATALSVALAG CGTSSDSGSG EGGDKTLTVW LMDGSAAPAL TDALHQEFES        60
     AHPGVKVKYE VQKWGGIQEK LTTALTGKTP PDVIELGNTQ TAKFASEDTL EDLSGDVSSL       120
     AGDQWLAGLE DSLTWDGKQY GMPFYAANRT VVYRTDLFQA AGITAAPTSR DEWVAAVEKL       180
     KAANASDPEF QSLYLPGQSW YVLLSFIWDE GGDVAKKDGD KWAGALDSAE AKAGLEFYKK       240
     LVDASGTKAP KDTDEATPQQ MEVFGTGKVG MMIGLPWELA GAVKADPTLE GKLGAFPIPS       300
     KTAGKTAPVF LGGSNLAIPA GSANPDLAKD YLKLLSSKKY QDLLAEGGSV PGTSTDTTKL       360
     ETTPVGKALA AAAPNGKVTP TTPTWAGVEA GQNPLKDMLT AYLTGAKSLD QATADANAAL       420
     TKTLAG                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page