(data stored in ACNUC7421 zone)

EMBL: CP001630.PE397

CP001630.PE397       Location/Qualifiers
FT   CDS             443873..444622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0404"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: UbiC transcription regulator-associated domain
FT                   protein; regulatory protein GntR HTH; SMART: regulatory
FT                   protein GntR HTH; KEGG: bcy:Bcer98_2752 GntR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34371"
FT                   /db_xref="GOA:C6WGQ5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGQ5"
FT                   /inference="protein motif:PFAM:PF07702"
FT                   /protein_id="ACU34371.1"
FT                   /translation="MLETSLESRSRAQREPKYWGLKRHLLDLLRAMPPGSPIPTERSLA
FT                   SEFDVSRTTVRQALAELTVEGRLLRVQGKGTFAAEPKVAQRLQLSSYTQDMLAQGRQPS
FT                   SRLIDASEQPAEAELARLLGVRAGAKVLRLHRLRLADGEPMAIETTHLALGRFRGLRRY
FT                   LSPGGSLYQVLRERFGTEMGHAEETIETALASPEEAELLGADIGLPMLLLSRHSYDTEG
FT                   NPVEWVRSVYRGDRYKFVATLNRPVEG"
     MLETSLESRS RAQREPKYWG LKRHLLDLLR AMPPGSPIPT ERSLASEFDV SRTTVRQALA        60
     ELTVEGRLLR VQGKGTFAAE PKVAQRLQLS SYTQDMLAQG RQPSSRLIDA SEQPAEAELA       120
     RLLGVRAGAK VLRLHRLRLA DGEPMAIETT HLALGRFRGL RRYLSPGGSL YQVLRERFGT       180
     EMGHAEETIE TALASPEEAE LLGADIGLPM LLLSRHSYDT EGNPVEWVRS VYRGDRYKFV       240
     ATLNRPVEG                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page