(data stored in ACNUC7421 zone)

EMBL: CP001630.PE398

CP001630.PE398       Location/Qualifiers
FT   CDS             complement(444671..445618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0405"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; KEGG: aba:Acid345_2084 pyridoxal-5'-phosphate-
FT                   dependent enzyme, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34372"
FT                   /db_xref="GOA:C6WGQ6"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR027278"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGQ6"
FT                   /inference="protein motif:PFAM:PF00291"
FT                   /protein_id="ACU34372.1"
FT                   /translation="MDLVTLEDIRAAAERISGAVLRTPLLPWGDGLWLKPESLQPVGAF
FT                   KIRGAYNALARLTPEDRARGVVAYSSGNHSQAVARAAREFGVPAVIVIPDNAPEVKVEA
FT                   TRALGAEVVRVPMAERESRALELAAERGAVLVPPFDHPDVIAGQGTIGLEIVADLPEVA
FT                   TVLVPVSGGGLLSGVAVAVKALRPDARVIGVEPELAADAGESFAAGRRVDWPAEDRART
FT                   IADGLRAQPSERTFAHIRAHVDGFAAVSEARIRAAVRELAVRARLVVEPSGATTLAAFL
FT                   ELRERGELGDGPVVAVLSGGNVDPALLAEVLREA"
     MDLVTLEDIR AAAERISGAV LRTPLLPWGD GLWLKPESLQ PVGAFKIRGA YNALARLTPE        60
     DRARGVVAYS SGNHSQAVAR AAREFGVPAV IVIPDNAPEV KVEATRALGA EVVRVPMAER       120
     ESRALELAAE RGAVLVPPFD HPDVIAGQGT IGLEIVADLP EVATVLVPVS GGGLLSGVAV       180
     AVKALRPDAR VIGVEPELAA DAGESFAAGR RVDWPAEDRA RTIADGLRAQ PSERTFAHIR       240
     AHVDGFAAVS EARIRAAVRE LAVRARLVVE PSGATTLAAF LELRERGELG DGPVVAVLSG       300
     GNVDPALLAE VLREA                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page