(data stored in ACNUC7421 zone)

EMBL: CP001630.PE399

CP001630.PE399       Location/Qualifiers
FT   CDS             complement(446394..447158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0406"
FT                   /product="Extradiol ring-cleavage dioxygenase class III
FT                   protein subunit B"
FT                   /note="PFAM: Extradiol ring-cleavage dioxygenase class III
FT                   protein subunit B; KEGG: scl:sce0163 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34373"
FT                   /db_xref="GOA:C6WGQ7"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR014436"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGQ7"
FT                   /inference="protein motif:PFAM:PF02900"
FT                   /protein_id="ACU34373.1"
FT                   /translation="MPVLYLGHGAPPLADDARWTGELHAWSEDLPRPEAVLVVSAHWEE
FT                   APLTLGATTPVPLTYDFWGFPQKYYEVTYDAPGAPALADEVTRLLGGDDRVARDPERGL
FT                   DHGAYVPLKELFPAADVPVLQVSMPTLDPRELFDLGRGLAPLREQGVLLVGSGFMTHNL
FT                   SCVDFRRGPDYAAPGWSEEFDDWAGRALAAGDVDGLLDFARKAPAAGVAHPRTEHLAPL
FT                   FVALGASLDQSAPRTAVEGFWYGLSKRSMQFG"
     MPVLYLGHGA PPLADDARWT GELHAWSEDL PRPEAVLVVS AHWEEAPLTL GATTPVPLTY        60
     DFWGFPQKYY EVTYDAPGAP ALADEVTRLL GGDDRVARDP ERGLDHGAYV PLKELFPAAD       120
     VPVLQVSMPT LDPRELFDLG RGLAPLREQG VLLVGSGFMT HNLSCVDFRR GPDYAAPGWS       180
     EEFDDWAGRA LAAGDVDGLL DFARKAPAAG VAHPRTEHLA PLFVALGASL DQSAPRTAVE       240
     GFWYGLSKRS MQFG                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page