(data stored in ACNUC7421 zone)

EMBL: CP001630.PE4

CP001630.PE4         Location/Qualifiers
FT   CDS             4728..5843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: bsu:BSU00040 recombination
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33978"
FT                   /db_xref="GOA:C6WCF7"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCF7"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ACU33978.1"
FT                   /translation="MYVRHLQVTDFRSWEHADLAFEPGVNVLVGRNGHGKTNLVEALGY
FT                   VATLGSHRVASDAPLIRSGAQRAVVRTAVVNEGRELLVELEITPGRANRARVNRGPVPR
FT                   PRDVLGILRTVLFAPEDLSLVRGDPGERRRFLDELLTLRAPRYAGVRSDYERVLRQRGA
FT                   LLKTVRSVRSAELGTLDVWDGHLAKHGAELLAARLDLVAAIAPHAAAAYAEVAPESRPA
FT                   LLSYRSSLGEAFPGTHDREVLEDALLAELHRLRPQEIDRGVCLVGPHRDDLELSLGELP
FT                   AKGYASHGESWSFALALRLGAYELLREEGAEPVLVLDDVFAELDRGRRRQLAKVAAAAE
FT                   QVFITAAVAEDVPEELDAARFHVGHGEVRRD"
     MYVRHLQVTD FRSWEHADLA FEPGVNVLVG RNGHGKTNLV EALGYVATLG SHRVASDAPL        60
     IRSGAQRAVV RTAVVNEGRE LLVELEITPG RANRARVNRG PVPRPRDVLG ILRTVLFAPE       120
     DLSLVRGDPG ERRRFLDELL TLRAPRYAGV RSDYERVLRQ RGALLKTVRS VRSAELGTLD       180
     VWDGHLAKHG AELLAARLDL VAAIAPHAAA AYAEVAPESR PALLSYRSSL GEAFPGTHDR       240
     EVLEDALLAE LHRLRPQEID RGVCLVGPHR DDLELSLGEL PAKGYASHGE SWSFALALRL       300
     GAYELLREEG AEPVLVLDDV FAELDRGRRR QLAKVAAAAE QVFITAAVAE DVPEELDAAR       360
     FHVGHGEVRR D                                                            371
//

If you have problems or comments...

PBIL Back to PBIL home page