(data stored in ACNUC7421 zone)

EMBL: CP001630.PE40

CP001630.PE40        Location/Qualifiers
FT   CDS             complement(44172..45191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0040"
FT                   /product="copper resistance D domain protein"
FT                   /note="PFAM: copper resistance D domain protein; KEGG:
FT                   bja:bll4878 copper export protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34014"
FT                   /db_xref="GOA:C6WCJ3"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCJ3"
FT                   /inference="protein motif:PFAM:PF05425"
FT                   /protein_id="ACU34014.1"
FT                   /translation="MTADRTSGPARPRARVAGGLLLGALAGVLVGLAIAGTGAAVGGPG
FT                   IAALVAQPLARVLLDLSATGVVGLSLLPRLLGAARPSATEPVLRLARPAAVVLSAVWAL
FT                   VALLSVVLRAHETRPDVPLTTARLLDYVQRVPAGQGLLFSAVCAVVCLGVGAVAVRRGE
FT                   AVPAELRVLVALFGLLPLPATGHASNRDFRDVAVVAMELHVLGAALWTGGLVALVVLVA
FT                   HRRGLLAEALPRFSRLATAALLVVTATGIGTGLLELAAAPGGGLPGSLVTTPYGLLLVG
FT                   KALCALALAGLGARIRWWLLPLVRRHRPTALVGWAAAELAVMGAAFGLAVVLSRAPVA"
     MTADRTSGPA RPRARVAGGL LLGALAGVLV GLAIAGTGAA VGGPGIAALV AQPLARVLLD        60
     LSATGVVGLS LLPRLLGAAR PSATEPVLRL ARPAAVVLSA VWALVALLSV VLRAHETRPD       120
     VPLTTARLLD YVQRVPAGQG LLFSAVCAVV CLGVGAVAVR RGEAVPAELR VLVALFGLLP       180
     LPATGHASNR DFRDVAVVAM ELHVLGAALW TGGLVALVVL VAHRRGLLAE ALPRFSRLAT       240
     AALLVVTATG IGTGLLELAA APGGGLPGSL VTTPYGLLLV GKALCALALA GLGARIRWWL       300
     LPLVRRHRPT ALVGWAAAEL AVMGAAFGLA VVLSRAPVA                              339
//

If you have problems or comments...

PBIL Back to PBIL home page