(data stored in ACNUC7421 zone)

EMBL: CP001630.PE400

CP001630.PE400       Location/Qualifiers
FT   CDS             complement(447158..447916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0407"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="KEGG: pca:Pcar_0607 thiamin biosynthesis protein;
FT                   TIGRFAM: thiamine-phosphate pyrophosphorylase; PFAM:
FT                   thiamine monophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34374"
FT                   /db_xref="GOA:C6WGQ8"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGQ8"
FT                   /inference="protein motif:TFAM:TIGR00693"
FT                   /protein_id="ACU34374.1"
FT                   /translation="MPGLDATQIRRRLADARLYLCTPHRPDLAEFADAALAGGVDVVQL
FT                   REKGMEARQELAALEVLAEACARHGALLAVNDRADVALAAGADVLHLGQDDLPVPLARR
FT                   VVGEEVVIGRSTHDVAQASAAAVEPGVDYFCTGPCWPTPTKPGRPAPGLDLVRAVAGWD
FT                   AARASAAGGPGGLGASGAGRPGAGAPGAGAAPPARPWFAIGGIDRHRLPEVISAGARRV
FT                   VVVRAITESSDPRAAAAWLKIQLSGVPSSP"
     MPGLDATQIR RRLADARLYL CTPHRPDLAE FADAALAGGV DVVQLREKGM EARQELAALE        60
     VLAEACARHG ALLAVNDRAD VALAAGADVL HLGQDDLPVP LARRVVGEEV VIGRSTHDVA       120
     QASAAAVEPG VDYFCTGPCW PTPTKPGRPA PGLDLVRAVA GWDAARASAA GGPGGLGASG       180
     AGRPGAGAPG AGAAPPARPW FAIGGIDRHR LPEVISAGAR RVVVVRAITE SSDPRAAAAW       240
     LKIQLSGVPS SP                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page