(data stored in ACNUC7421 zone)

EMBL: CP001630.PE401

CP001630.PE401       Location/Qualifiers
FT   CDS             448503..449510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0408"
FT                   /product="glycine oxidase ThiO"
FT                   /note="TIGRFAM: glycine oxidase ThiO; PFAM: FAD dependent
FT                   oxidoreductase; KEGG: azc:AZC_3554 putative glycine oxidase
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34375"
FT                   /db_xref="GOA:C6WGQ9"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR012727"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGQ9"
FT                   /inference="protein motif:TFAM:TIGR02352"
FT                   /protein_id="ACU34375.1"
FT                   /translation="MARKRVTVLGGGVIGLSIAWRAAQAGFAVAVRDRGSAHAGSWVAG
FT                   GMLAPVSEAWPGDEAVLALGLESIRLWPGFARELGVRLNTAGTLLTAVDAADAAVLDQH
FT                   AAHLAAHGLEFQVLGAAGLREREPGLGPSVRSGLSIPGDLAVSARTLLAALRTACAEAG
FT                   VRFTGAAESEVDGSTTVIAAGAWSAELHPALRDVIHPVKGEILSLLARPGALEAPERTI
FT                   RAQVRGRAVYLVPNETRSGLLVGATQYEAGFDPTVRVRGVLDLLTDAEEVWPALTEYAL
FT                   AETSVGFRAGSRDNTPLIDWLEPGVLAATGHHRNGVLLAPVTARRVVELLGEAA"
     MARKRVTVLG GGVIGLSIAW RAAQAGFAVA VRDRGSAHAG SWVAGGMLAP VSEAWPGDEA        60
     VLALGLESIR LWPGFARELG VRLNTAGTLL TAVDAADAAV LDQHAAHLAA HGLEFQVLGA       120
     AGLREREPGL GPSVRSGLSI PGDLAVSART LLAALRTACA EAGVRFTGAA ESEVDGSTTV       180
     IAAGAWSAEL HPALRDVIHP VKGEILSLLA RPGALEAPER TIRAQVRGRA VYLVPNETRS       240
     GLLVGATQYE AGFDPTVRVR GVLDLLTDAE EVWPALTEYA LAETSVGFRA GSRDNTPLID       300
     WLEPGVLAAT GHHRNGVLLA PVTARRVVEL LGEAA                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page