(data stored in ACNUC7421 zone)

EMBL: CP001630.PE403

CP001630.PE403       Location/Qualifiers
FT   CDS             449707..450495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0410"
FT                   /product="thiazole biosynthesis family protein"
FT                   /note="PFAM: thiazole biosynthesis family protein; KEGG:
FT                   rce:RC1_3100 thiazole biosynthesis protein ThiG"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34377"
FT                   /db_xref="GOA:C6WGR1"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGR1"
FT                   /inference="protein motif:PFAM:PF05690"
FT                   /protein_id="ACU34377.1"
FT                   /translation="MTEPDRIAPAPDPLRIADREFTSRLITGTGGATNLTVLERALRAS
FT                   GTELTTVALRRADGSGGTGVLQLLRRLGIDLLPNTAGCRTAAEAVLTARLAREALGTSW
FT                   VKLEVHADDRTLLPDPVETLDAARRLVADGFTVLPYTNDDPVLALRLEDAGCAAVMPLG
FT                   SPIGTGLGIRNPHNLELIVARASVPVILDAGVGTASDAAVAMELGCAAVLLATAVTRAQ
FT                   DPELMASAMRSAVRAGRWARLAGRAPKRFWAHASSPAPDA"
     MTEPDRIAPA PDPLRIADRE FTSRLITGTG GATNLTVLER ALRASGTELT TVALRRADGS        60
     GGTGVLQLLR RLGIDLLPNT AGCRTAAEAV LTARLAREAL GTSWVKLEVH ADDRTLLPDP       120
     VETLDAARRL VADGFTVLPY TNDDPVLALR LEDAGCAAVM PLGSPIGTGL GIRNPHNLEL       180
     IVARASVPVI LDAGVGTASD AAVAMELGCA AVLLATAVTR AQDPELMASA MRSAVRAGRW       240
     ARLAGRAPKR FWAHASSPAP DA                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page