(data stored in ACNUC7421 zone)

EMBL: CP001630.PE404

CP001630.PE404       Location/Qualifiers
FT   CDS             450580..450999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0411"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: bcm:Bcenmc03_5734 MarR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34378"
FT                   /db_xref="GOA:C6WGR2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGR2"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACU34378.1"
FT                   /translation="MTDLEDATARLYLTIGRLSRLLRRTGSPGLGPGAVSALATLARCG
FT                   PMRLGDLANKEGVAPPTLSRIVATLVEAGYVRREPDPQDGRAWLASPTDEGVAMVSGVR
FT                   SARVQELRARLESLSPEHRDALVGALGALEALVEE"
     MTDLEDATAR LYLTIGRLSR LLRRTGSPGL GPGAVSALAT LARCGPMRLG DLANKEGVAP        60
     PTLSRIVATL VEAGYVRREP DPQDGRAWLA SPTDEGVAMV SGVRSARVQE LRARLESLSP       120
     EHRDALVGAL GALEALVEE                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page