(data stored in ACNUC7421 zone)

EMBL: CP001630.PE405

CP001630.PE405       Location/Qualifiers
FT   CDS             complement(451015..451833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0412"
FT                   /product="O-methyltransferase domain protein"
FT                   /note="PFAM: O-methyltransferase domain protein; KEGG:
FT                   mlo:mll3178 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34379"
FT                   /db_xref="GOA:C6WGR3"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR016874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGR3"
FT                   /inference="protein motif:PFAM:PF02409"
FT                   /protein_id="ACU34379.1"
FT                   /translation="MDRVRVALTGAQETMLATLYGRALDSARPHSVLNDGAAAEAVARL
FT                   DYDFPGTGLTMTSAVGVAIRAWQLDRWLRGFLAEHPRATVLHLACGLDTRAHRLSPGPD
FT                   VRWVDVDLPDVVAVREKVLPPPGGDYRLVGASATSPELWESIPDDRPTAVVFEGLSMYL
FT                   SGAEVEGMVRRAVGRFPSGELMFDVYGTIGIRLQKLVPPVRRAGAVLRWGLDDPTGPEA
FT                   WGLKLVESVRSTEMPMLDRLPLAGRVQLRIVGLIPRLRDAGRAVRYRFPA"
     MDRVRVALTG AQETMLATLY GRALDSARPH SVLNDGAAAE AVARLDYDFP GTGLTMTSAV        60
     GVAIRAWQLD RWLRGFLAEH PRATVLHLAC GLDTRAHRLS PGPDVRWVDV DLPDVVAVRE       120
     KVLPPPGGDY RLVGASATSP ELWESIPDDR PTAVVFEGLS MYLSGAEVEG MVRRAVGRFP       180
     SGELMFDVYG TIGIRLQKLV PPVRRAGAVL RWGLDDPTGP EAWGLKLVES VRSTEMPMLD       240
     RLPLAGRVQL RIVGLIPRLR DAGRAVRYRF PA                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page