(data stored in ACNUC7421 zone)

EMBL: CP001630.PE406

CP001630.PE406       Location/Qualifiers
FT   CDS             complement(451917..452123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0413"
FT                   /product="protein of unknown function DUF397"
FT                   /note="PFAM: protein of unknown function DUF397"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34380"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGR4"
FT                   /inference="protein motif:PFAM:PF04149"
FT                   /protein_id="ACU34380.1"
FT                   /translation="MIGMLEGAKWKKSLRSGNSGGNCVEMACGTSSARAIRDSKNPAHG
FT                   ALVLDGDTAARFLDGLKAGRFGR"
     MIGMLEGAKW KKSLRSGNSG GNCVEMACGT SSARAIRDSK NPAHGALVLD GDTAARFLDG        60
     LKAGRFGR                                                                 68
//

If you have problems or comments...

PBIL Back to PBIL home page