(data stored in ACNUC7421 zone)

EMBL: CP001630.PE407

CP001630.PE407       Location/Qualifiers
FT   CDS             complement(452143..452997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0414"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34381"
FT                   /db_xref="GOA:C6WGR5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGR5"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACU34381.1"
FT                   /translation="MVDRSAQHHTAVYKRKLGEVLETCREEAGLSRADAAAVLDCSTSK
FT                   IRMIESGGVAVKTPELRELLTAYNITGERRADIETLGEHARQRRGRTTWGGAVPERLKR
FT                   FFDKEETAVTIDSYSPWVLQGLAQTEAHARAVIQTNSLLSPKDVDRLVQARLARQERLH
FT                   AQDAPKIRWAVDESVLRRPIGGAEVMRAQLEHLAALCRKDIGELRVIPNSVGAHAGCGF
FT                   PFVVLVDAEGNRSVYVENLTDGSWIEDLDRVTRYEITMREIMDCALSTEESLRLVDTVL
FT                   AQL"
     MVDRSAQHHT AVYKRKLGEV LETCREEAGL SRADAAAVLD CSTSKIRMIE SGGVAVKTPE        60
     LRELLTAYNI TGERRADIET LGEHARQRRG RTTWGGAVPE RLKRFFDKEE TAVTIDSYSP       120
     WVLQGLAQTE AHARAVIQTN SLLSPKDVDR LVQARLARQE RLHAQDAPKI RWAVDESVLR       180
     RPIGGAEVMR AQLEHLAALC RKDIGELRVI PNSVGAHAGC GFPFVVLVDA EGNRSVYVEN       240
     LTDGSWIEDL DRVTRYEITM REIMDCALST EESLRLVDTV LAQL                        284
//

If you have problems or comments...

PBIL Back to PBIL home page